Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 5
Funding $990,361
PubMed Score 21.68
PubTator Score 20.37

Knowledge Summary

Patent (9,444)

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.393 0.000
colon cancer -2.200 0.000
interstitial cystitis 1.200 0.001

Gene RIF (7)

PMID Text
26028029 PSGR overexpression synergizes with loss of PTEN to accelerate prostate cancer development, and present a novel bigenic mouse model that mimics the human condition
25219547 Pyk2-NDRG1 axis is possibly involved in conveying the anti-proliferative effect of beta-ionone in prostate cancer cells.
19389702 We identified androstenone derivatives as ligands for the recombinant receptor PSGR
16491480 expression of PSGR and PSGR2 relative to AMACR in prostate cancer; AMACR was the most overexpressed, but in some cases expression of AMACR was not significantly elevated while PSGR and/or PSGR2 were substantially elevated
16231015 PSGR overexpression is associated with higher percentage of pathologic stage, pT3, and a higher level of preoperative serum PSA in Prostate Cancer
16149059 two functional promoters regulate the transcriptional expression of PSGR in human prostate tissues, and PSGR is a new target for IL-6 transcriptional regulation
15499628 Increased expression of prostate-specific G-protein-coupled receptor is associated with prostate intraepithelial neoplasia and prostate cancers

AA Sequence

MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYLFLCMLAAIDL      1 - 70
ALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFDRYVAICHPLRHAAVLNNTVT     71 - 140
AQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVHQDVMKLAYADTLPNVVYGLTAILLVMGVDV    141 - 210
MFISLSYFLIIRTVLQLPSKSERAKAFGTCVSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYL    211 - 280
LLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK                                  281 - 320
//

Text Mined References (17)

PMID Year Title
26028029 2016 Prostate-specific G-protein-coupled receptor collaborates with loss of PTEN to promote prostate cancer progression.
25219547 2015 Quantitative phosphoproteomics reveals the protein tyrosine kinase Pyk2 as a central effector of olfactory receptor signaling in prostate cancer cells.
23401498 2013 Olfactory receptor responding to gut microbiota-derived signals plays a role in renin secretion and blood pressure regulation.
19389702 2009 Activation of an olfactory receptor inhibits proliferation of prostate cancer cells.
16491480 2006 The prostate-specific G-protein coupled receptors PSGR and PSGR2 are prostate cancer biomarkers that are complementary to alpha-methylacyl-CoA racemase.
16231015 2006 Quantitative expression profile of PSGR in prostate cancer.
16149059 2005 Regulation of human prostate-specific G-protein coupled receptor, PSGR, by two distinct promoters and growth factors.
15499628 2005 Increased expression of prostate-specific G-protein-coupled receptor in human prostate intraepithelial neoplasia and prostate cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
More...