Property Summary

NCBI Gene PubMed Count 16
PubMed Score 21.68
PubTator Score 20.37

Knowledge Summary

Patent (9,444)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
colon cancer 1475 1.23202262698077E-5
cystic fibrosis 1670 6.3984449598097E-5
interstitial cystitis 2299 0.00121360525131195
Disease Target Count Z-score Confidence
Hemolytic anemia 70 0.0 2.0
Disease Target Count Z-score Confidence
Prostate cancer 172 4.169 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.393 0.000
colon cancer -2.200 0.000
interstitial cystitis 1.200 0.001

Synonym

Accession Q9H255 B2RA63 Q6IF94
Symbols PSGR
OR52A2
OR51E3P

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA Inparanoid

Gene RIF (7)

PMID Text
26028029 PSGR overexpression synergizes with loss of PTEN to accelerate prostate cancer development, and present a novel bigenic mouse model that mimics the human condition
25219547 Pyk2-NDRG1 axis is possibly involved in conveying the anti-proliferative effect of beta-ionone in prostate cancer cells.
19389702 We identified androstenone derivatives as ligands for the recombinant receptor PSGR
16491480 expression of PSGR and PSGR2 relative to AMACR in prostate cancer; AMACR was the most overexpressed, but in some cases expression of AMACR was not significantly elevated while PSGR and/or PSGR2 were substantially elevated
16231015 PSGR overexpression is associated with higher percentage of pathologic stage, pT3, and a higher level of preoperative serum PSA in Prostate Cancer
16149059 two functional promoters regulate the transcriptional expression of PSGR in human prostate tissues, and PSGR is a new target for IL-6 transcriptional regulation
15499628 Increased expression of prostate-specific G-protein-coupled receptor is associated with prostate intraepithelial neoplasia and prostate cancers

AA Sequence

MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYLFLCMLAAIDL      1 - 70
ALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFDRYVAICHPLRHAAVLNNTVT     71 - 140
AQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVHQDVMKLAYADTLPNVVYGLTAILLVMGVDV    141 - 210
MFISLSYFLIIRTVLQLPSKSERAKAFGTCVSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYL    211 - 280
LLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK                                  281 - 320
//

Text Mined References (17)

PMID Year Title
26028029 2016 Prostate-specific G-protein-coupled receptor collaborates with loss of PTEN to promote prostate cancer progression.
25219547 2015 Quantitative phosphoproteomics reveals the protein tyrosine kinase Pyk2 as a central effector of olfactory receptor signaling in prostate cancer cells.
23401498 2013 Olfactory receptor responding to gut microbiota-derived signals plays a role in renin secretion and blood pressure regulation.
19389702 2009 Activation of an olfactory receptor inhibits proliferation of prostate cancer cells.
16491480 2006 The prostate-specific G-protein coupled receptors PSGR and PSGR2 are prostate cancer biomarkers that are complementary to alpha-methylacyl-CoA racemase.
16231015 2006 Quantitative expression profile of PSGR in prostate cancer.
16149059 2005 Regulation of human prostate-specific G-protein coupled receptor, PSGR, by two distinct promoters and growth factors.
15499628 2005 Increased expression of prostate-specific G-protein-coupled receptor in human prostate intraepithelial neoplasia and prostate cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
More...