Property Summary

NCBI Gene PubMed Count 18
PubMed Score 25.28
PubTator Score 20.37

Knowledge Summary

Patent (9,444)

TINX Plot

  Disease (4)

Disease Target Count P-value
colon cancer 1478 1.2e-05
cystic fibrosis 1696 6.4e-05
interstitial cystitis 2312 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0
Malaria 160 0.0 0.8
Disease Target Count Z-score Confidence
Prostate cancer 175 4.21 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -2.200 1.2e-05
cystic fibrosis -1.393 6.4e-05
interstitial cystitis 1.200 1.2e-03

Protein-protein Interaction (8)

Gene RIF (9)

AA Sequence

MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYLFLCMLAAIDL      1 - 70
ALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFDRYVAICHPLRHAAVLNNTVT     71 - 140
AQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVHQDVMKLAYADTLPNVVYGLTAILLVMGVDV    141 - 210
MFISLSYFLIIRTVLQLPSKSERAKAFGTCVSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYL    211 - 280
LLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK                                  281 - 320
//

Text Mined References (19)

PMID Year Title