Property Summary

NCBI Gene PubMed Count 171
Grant Count 136
R01 Count 76
Funding $12,900,196.41
PubMed Score 1370.84
PubTator Score 1218.96

Knowledge Summary

Patent (11,245)

TINX Plot

  Disease Relevance (46)

Disease Z-score Confidence
Coronary artery disease 240 6.928 3.5
Cerebrovascular disease 231 5.294 2.6
Atrial Fibrillation 110 3.804 1.9
Transient cerebral ischemia 14 3.679 1.8
diabetes mellitus 1,663 3.587 1.8
Peripheral artery disease 8 3.3 1.7
Acute ST segment elevation myocardial in... 1 
Acute coronary syndrome 37
Bleeding Disorder Due To P2RY12 Defect 2
Breast cancer 3,094
Cerebral embolism 3
Cerebrovascular Occlusion 5
Drug Metabolism, Poor, CYP2C19-Related 2
Hemorrhage 18
Lupus Erythematosus, Systemic 73
Myocardial Infarction 126
Myocardial Reinfarction Prevention 6
Non-Q wave myocardial infarction 4
Percutaneous coronary intervention 10
Peripheral Arterial Thromboembolism Prev... 2 
Peripheral vascular disease 90
Prevention of Cerebral Thrombosis 29
Subacute Stent Thrombosis Prevention 5
Thrombosis 42
adrenocortical carcinoma 1,427
atypical teratoid / rhabdoid tumor 4,369
ductal carcinoma in situ 1,745
gastric cancer 430
glioblastoma multiforme 347
group 3 medulloblastoma 2,254
head and neck cancer and chronic obstruc... 237 
hepatocellular carcinoma 532
intraductal papillary-mucinous carcinoma... 2,988 
invasive ductal carcinoma 2,950
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
non-small cell lung cancer 2,798
oligodendroglioma 2,849
pancreatic cancer 2,300
pancreatic carcinoma 567
pilocytic astrocytoma 3,086
pituitary cancer 1,972
primary Sjogren syndrome 789
primitive neuroectodermal tumor 3,031
sarcoidosis 358
tuberculosis 1,557

Expression

Synonym

Accession Q9H244 D3DNJ5 Q546J7 P2Y12
Symbols HORK3
P2Y12
ADPG-R
BDPLT8
SP1999
P2T(AC)
P2Y(AC)
P2Y(12)R
P2Y(ADP)
P2Y(cyc)

Gene

PANTHER Protein Class (2)

PDB

1T78   1VZ1   1Y9C   4NTJ   4PXZ   4PY0  

  TechDev Info (1)

Gene RIF (169)

PMID Text
26885820 The ratio of ADP- to TRAP-induced platelet aggregation quantifies P2Y12-dependent platelet inhibition independently of the platelet count in contrast to conventional ADP-induced aggregation.
26870959 PON1, P2Y12 and COX1 polymorphisms were associated with poorer vascular outcomes in patients with extracranial or intracranial stents.
26743169 Synergistic inhibition of both P2Y1 and P2Y12 adenosine diphosphate receptors by GLS-409 immediately attenuates platelet-mediated thrombosis and effectively blocks agonist-stimulated platelet aggregation irrespective of concomitant aspirin therapy.
26391841 ADP stimulation of P2Y12 led to cAMP decrease that, in turn, caused changes in phospholipase C phosphorylation by protein kinase A, increase in cytoplasmic calcium level and, consequently, PS+ platelet formation
26354056 Report appropriate P2Y12 inhibitor regimen to prevent increased bleeding risk and maintain antiplatelet efficacy in East Asian patients with acute coronary syndrome. in Korean patients
26353776 While there is increasing evidence for the cancer-protective effect of aspirin, this study suggests P2Y12 inhibition may also play a role.
26311415 In non-ST elevation acute coronary syndrome patients undergoing PCI a loading dose of ticagrelor or prasugrel given during the procedure provides optimal P2Y12-ADP receptor blockade in 2 h and maximal inhibition within 4 h.
26083990 Baseline platelet aggregation was increased in carriers of the common alleles of P2Y12 SNPs rs1907637, rs2046934, and rs6809699 and rs6787801 TC heterozygotes.
25838093 Leukotriene E4 may play some important roles in allergic mucus secretion partially via activation of P2Y12 receptor
25778862 This is the first study to demonstrate that the genetic polymorphisms of P2RY12 can affect platelet and eosinophil activation in patients with aspirin-exacerbated respiratory disease after aspirin exposure.
More...

AA Sequence

MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISD      1 - 70
LLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLG     71 - 140
AKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYT    141 - 210
LITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVK    211 - 280
ESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM            281 - 342
//

Text Mined References (171)

PMID Year Title
26885820 2016 The Ratio of ADP- to TRAP-Induced Platelet Aggregation Quantifies P2Y12-Dependent Platelet Inhibition Independently of the Platelet Count.
26870959 2016 Association of PON1, P2Y12 and COX1 with Recurrent Ischemic Events in Patients with Extracranial or Intracranial Stenting.
26743169 2016 Synergistic Inhibition of Both P2Y1 and P2Y12 Adenosine Diphosphate Receptors As Novel Approach to Rapidly Attenuate Platelet-Mediated Thrombosis.
26391841 2015 Modulation and pre-amplification of PAR1 signaling by ADP acting via the P2Y12 receptor during platelet subpopulation formation.
26354056 2015 A pharmacodynamic study of the optimal P2Y12 inhibitor regimen for East Asian patients with acute coronary syndrome.
26353776 2015 Aspirin and P2Y12 inhibition attenuate platelet-induced ovarian cancer cell invasion.
26311415 2015 Onset of optimal P2Y12-ADP receptor blockade after ticagrelor and prasugrel intake in Non-ST elevation acute coronary syndrome.
26083990 2015 Influence of P2Y12 polymorphisms on platelet activity but not ex-vivo antiplatelet effect of ticagrelor in healthy Chinese male subjects.
25838093 2015 Leukotriene E4 induces MUC5AC release from human airway epithelial NCI-H292 cells.
25778862 2015 Association of P2RY12 polymorphisms with eosinophil and platelet activation in patients with aspirin-exacerbated respiratory disease.
More...