Property Summary

NCBI Gene PubMed Count 31
PubMed Score 45.19
PubTator Score 42.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 2.0e-03
breast carcinoma -1.200 1.0e-03
cystic fibrosis -1.200 2.5e-04
ductal carcinoma in situ -2.100 1.5e-03
ependymoma -1.100 2.0e-04
fibroadenoma -1.400 3.9e-02
group 3 medulloblastoma -1.100 3.7e-02
interstitial cystitis -1.700 1.2e-03
intraductal papillary-mucinous adenoma (... 2.300 1.9e-03
intraductal papillary-mucinous neoplasm ... 2.600 4.3e-03
invasive ductal carcinoma -2.200 8.7e-03
lung cancer -1.200 1.4e-02
lung carcinoma -1.100 8.2e-19
medulloblastoma, large-cell -1.100 6.9e-03
non-small cell lung cancer -2.476 2.4e-28
osteosarcoma -1.440 3.4e-02
ovarian cancer -2.000 3.4e-17
pancreatic cancer 1.400 8.8e-04
primary pancreatic ductal adenocarcinoma 1.382 2.9e-02
primitive neuroectodermal tumor -1.200 2.3e-02
psoriasis -2.300 9.8e-11
ulcerative colitis -1.800 5.4e-04

Gene RIF (17)

AA Sequence

MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWVS      1 - 70
QLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRKKRFAKQGNKWYKQHLSYRLV     71 - 140
NWPEHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGDHNDGLGNAFDGPGGALAHAFL    141 - 210
PRRGEAHFDQDERWSLSRRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQ    211 - 280
SLYGKPLGGSVAVQLPGKLFTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEV    281 - 350
AADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCRAGGLPRHPDA    351 - 420
ALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQ    421 - 490
AKLQATTSGRWATELPWMGCWHANSGSALF                                            491 - 520
//

Text Mined References (33)

PMID Year Title