Property Summary

NCBI Gene PubMed Count 29
Grant Count 15
R01 Count 8
Funding $1,821,841.5
PubMed Score 42.49
PubTator Score 42.72

Knowledge Summary

Patent

No data available

Gene RIF (16)

PMID Text
25429835 These results proved for the first time that epilysin expression was significantly elevated in glioblastoma
24710352 A decreased level of IL-33 and an elevated concentration of MMP-28 were found in coronary heart disease patients and correlated with disease severity.
24167355 MMP28 mRNA expression is highest in healthy tissues when compared to diseased periodontal tissues.
23803888 Inhibition of BCMO1 expression is associated with increased invasiveness of colon cancer cells and increased expression of MMP7 and MMP28. beta-Carotene can upregulate BCMO1 and reverse these effects.
23549873 Data established a seven-gene (AR, ESR2, GATA3, GBX2, KRT16, MMP28 and WNT11) prognostic signature to define a subset of triple-negative breast cancer (TNBC).
22040290 Over-expression of MMP28 provides protection against apoptosis induced by either serum-deprivation or treatment with a protein kinase inhibitor.
21801383 Gene expression of MMP28 in the intervertebral disk is not regulated by inflammatory mechanisms, is donor-dependent and cannot be positively or negatively linked to the grade of degeneration and only weakly to the occurrence of trauma.
21723775 basal expression of MMP-2, MMP-9, MMP-28, and Filaggrin was evaluated in oral keratinocytes to collect information about ability of cigarette smoke to modify basal expression pattern of these key enzymes in the absence of clinical signs in oral epithelium
21615884 MMP28 is frequently overexpressed during progression of gastric carcinoma, and contributes to tumor cell invasion and metastasis.
20144149 MMP28 gene expression is regulated by Sp1 transcription factor acetylation.
More...

AA Sequence

MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWVS      1 - 70
QLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRKKRFAKQGNKWYKQHLSYRLV     71 - 140
NWPEHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGDHNDGLGNAFDGPGGALAHAFL    141 - 210
PRRGEAHFDQDERWSLSRRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQ    211 - 280
SLYGKPLGGSVAVQLPGKLFTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEV    281 - 350
AADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCRAGGLPRHPDA    351 - 420
ALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQ    421 - 490
AKLQATTSGRWATELPWMGCWHANSGSALF                                            491 - 520
//

Text Mined References (31)

PMID Year Title
25429835 2015 Epilysin is overexpressed in glioblastoma and related to clinical outcome of patients.
24710352 2014 Characterization of interleukin-33 and matrix metalloproteinase-28 in serum and their association with disease severity in patients with coronary heart disease.
24385575 2014 MMP28 and macrophage polarization: orchestrating the attack of the mac.
24167355 2013 mRNA expression of MMP-28 (Epilysin) in gingival tissues of chronic and aggressive periodontitis patients: a reverse transcriptase PCR study.
23964118 2014 MMP28 promotes macrophage polarization toward M2 cells and augments pulmonary fibrosis.
23803888 2013 ?,?-carotene 15,15'-monooxygenase and its substrate ?-carotene modulate migration and invasion in colorectal carcinoma cells.
23549873 2013 Identification of prognosis-relevant subgroups in patients with chemoresistant triple-negative breast cancer.
22040290 2011 Epilysin (matrix metalloproteinase-28) contributes to airway epithelial cell survival.
21801383 2011 Human MMP28 expression is unresponsive to inflammatory stimuli and does not correlate to the grade of intervertebral disc degeneration.
21723775 2011 Chronic exposure to cigarette smoke increases matrix metalloproteinases and Filaggrin mRNA expression in oral keratinocytes: role of nicotine stimulation.
More...