Property Summary

Ligand Count 24
NCBI Gene PubMed Count 38
PubMed Score 156.20
PubTator Score 107.44

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

AA Sequence

MATFSRQEFFQQLLQGCLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQL      1 - 70
HMVWVVLLSLLCYLVLFLCRHSSHRGVFLSVTILIYLLMGEMHMVDTVTWHKMRGAQMIVAMKAVSLGFD     71 - 140
LDRGEVGTVPSPVEFMGYLYFVGTIVFGPWISFHSYLQAVQGRPLSCRWLQKVARSLALALLCLVLSTCV    141 - 210
GPYLFPYFIPLNGDRLLRNKKRKARGTMVRWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHL    211 - 280
EWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAV    281 - 350
LLSLAFITYVEHVLRKRLARILSACVLSKRCPPDCSHQHRLGLGVRALNLLFGALAIFHLAYLGSLFDVD    351 - 420
VDDTTEEQGYGMAYTVHKWSELSWASHWVTFGCWIFYRLIG                                 421 - 461
//

Text Mined References (38)

PMID Year Title