Property Summary

NCBI Gene PubMed Count 26
Grant Count 18
R01 Count 14
Funding $810,546.12
PubMed Score 42.56
PubTator Score 25.95

Knowledge Summary

Patent (9,777)

Expression

  Differential Expression (12)

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
1801 summary 2 / 0 / 0 Summary of probe development efforts to identify agonists of Sphingosine 1-Phosphate Receptor 4 (S1P4)
2350 confirmatory 3 / 0 / 18 Late stage counterscreen assay for S1P4 antagonists: Fluorescence dose response cell-based screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 5 (S1P5)
463129 confirmatory 1 / 0 / 5 Late-stage fluorescence-based dose-response cell-based assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Sphingosine 1-Phosphate Receptor 5 (S1P5) counterscreen assay
504867 confirmatory 10 / 0 / 2 Late-stage fluorescence-based dose-response cell-based counterscreen assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Sphingosine 1-Phosphate Receptor 5 (S1P5) agonist assay Set 2
504869 confirmatory 0 / 0 / 1 Late-stage fluorescence-based dose-response cell-based counterscreen assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Sphingosine 1-Phosphate Receptor 5 (S1P5) antagonist assay Set 2
540309 summary 5 / 0 / 0 Summary of probe development efforts to identify agonists of Sphingosine 1-Phosphate Receptor 3 (S1P3)
540369 confirmatory 0 / 0 / 1 Late-stage fluorescence-based dose-response cell-based counterscreen assay to identify agonists of the Sphingosine 1-Phosphate Receptor 3 (S1P3): Sphingosine 1-Phosphate Receptor 5 (S1P5) agonist assay

Gene RIF (12)

PMID Text
25601519 TGF-beta2 dependent upregulation of S1P5 is required for the induction of pro-fibrotic CTGF by TGF-beta in mesangial cells.
24903384 Data show that sphingosine kinase SphK1 and sphingosine-1-phosphate (S1P) receptors S1P1, S1P2, S1P3, and S1P5 were expressed from primary, up to recurrent and secondary glioblastomas, with sphingosine kinase SphK2 levels were highest in primary tumors.
23551178 This report is the first to demonstrate a reduction in S1P5 in multiple sclerosis lesions, which parallels that of myelin loss.
22715976 Edg-5 receptor in brain endothelial cells contributes to optimal barrier formation and maintenance of immune quiescence of the barrier endothelium.
22541110 The decreased expression level of S1PR5 on NK cells is associated with graft versus host disease occurrence after allogeneic hematopoietic stem cell transplantation.
20950786 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19474291 Results suggest that, under serum-starved conditions, sphingosine 1-phosphate (S1P) further upregulates autophagic activity through S1P(5)-dependent pathways in PC-3 cells.
19211033 The centrosomal sphingosine-1-phosphate receptor 5 might function as an intracellular target of sphingosine-1-phosphate linked to regulation of mitosis.
17918267 FTY720 induces time-dependent modulation of S1P receptors on human OPCs with consequent functional responses that are directly relevant for the remyelination process.
12427546 identify and characterize the gene; describe its expression in normal tissues and large granular lymphocyte leukemia monocytes
More...

AA Sequence

MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLVLGRHPRFHAP      1 - 70
MFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALTASVLSLLAIALERSLTMARR     71 - 140
GPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLDACSTVLPLYAKAYVLFCVLAFVGILAAICA    141 - 210
LYARIYCQVRANARRLPARPGTAGTTSTRARRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPAR    211 - 280
TCPVLLQADPFLGLAMANSLLNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRR    281 - 350
CLPPGLDGSFSGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD                          351 - 398
//

Text Mined References (26)

PMID Year Title
25601519 2015 Transforming growth factor ?2 (TGF-?2)-induced connective tissue growth factor (CTGF) expression requires sphingosine 1-phosphate receptor 5 (S1P5) in human mesangial cells.
24903384 2014 The role of sphingosine kinase isoforms and receptors S1P1, S1P2, S1P3, and S1P5 in primary, secondary, and recurrent glioblastomas.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
23551178 2014 Immunohistochemical detection of sphingosine-1-phosphate receptor 1 and 5 in human multiple sclerosis lesions.
22715976 2012 Sphingosine 1-phosphate receptor 5 mediates the immune quiescence of the human brain endothelial barrier.
22541110 2012 [Influence of NK cell S1PR5 expression on graft versus host disease in allogeneic hematopoietic stem cell transplantation].
20950786 2010 A genome-wide study reveals copy number variants exclusive to childhood obesity cases.
19474291 2009 S1P(5) is required for sphingosine 1-phosphate-induced autophagy in human prostate cancer PC-3 cells.
19211033 2009 The sphingosine 1-phosphate receptor 5 and sphingosine kinases 1 and 2 are localised in centrosomes: possible role in regulating cell division.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
More...