Property Summary

Ligand Count 143
NCBI Gene PubMed Count 28
PubMed Score 47.15
PubTator Score 25.95

Knowledge Summary

Patent (9,777)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.800 3.6e-02
Astrocytoma, Pilocytic -1.400 5.3e-04
atypical teratoid/rhabdoid tumor -1.300 4.9e-04
ependymoma -1.100 4.3e-02
group 3 medulloblastoma -1.700 1.6e-02
interstitial cystitis -1.300 4.5e-03
non-small cell lung cancer 1.033 2.1e-06
osteosarcoma 1.564 1.2e-06
pediatric high grade glioma -1.200 1.7e-03
primitive neuroectodermal tumor -1.300 3.9e-03
subependymal giant cell astrocytoma -1.747 7.3e-03
type I diabetes mellitus -1.246 2.3e-02

Gene RIF (14)

AA Sequence

MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLVLGRHPRFHAP      1 - 70
MFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALTASVLSLLAIALERSLTMARR     71 - 140
GPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLDACSTVLPLYAKAYVLFCVLAFVGILAAICA    141 - 210
LYARIYCQVRANARRLPARPGTAGTTSTRARRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPAR    211 - 280
TCPVLLQADPFLGLAMANSLLNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRR    281 - 350
CLPPGLDGSFSGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD                          351 - 398
//

Text Mined References (28)

PMID Year Title