Property Summary

NCBI Gene PubMed Count 17
PubMed Score 25.18
PubTator Score 187.65

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H227 Q32LY7 Q3MIH4 Q53GG8 Q6NSF4 Q8NHT8 Q9H3T4 Q9H4C6
Symbols CBG
GLUC
KLRP
CBGL1

Gene

PANTHER Protein Class (2)

PDB

2E9L   2E9M   2JFE   2ZOX   3VKK  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (27)

AA Sequence

MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLG      1 - 70
LTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYHFDLPQTLEDQGGWLSEAIIE     71 - 140
SFDKYAQFCFSTFGDRVKQWITINEANVLSVMSYDLGMFPPGIPHFGTGGYQAAHNLIKAHARSWHSYDS    141 - 210
LFRKKQKGMVSLSLFAVWLEPADPNSVSDQEAAKRAITFHLDLFAKPIFIDGDYPEVVKSQIASMSQKQG    211 - 280
YPSSRLPEFTEEEKKMIKGTADFFAVQYYTTRLIKYQENKKGELGILQDAEIEFFPDPSWKNVDWIYVVP    281 - 350
WGVCKLLKYIKDTYNNPVIYITENGFPQSDPAPLDDTQRWEYFRQTFQELFKAIQLDKVNLQVYCAWSLL    351 - 420
DNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL                         421 - 469
//

Text Mined References (17)

PMID Year Title