Property Summary

NCBI Gene PubMed Count 22
PubMed Score 13.04
PubTator Score 211.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 4.06368912688514E-11
pilocytic astrocytoma 3086 2.12628089006641E-7
ovarian cancer 8492 8.28753447989871E-7
hepatocellular carcinoma 550 7.7252335090837E-5
tuberculosis 1563 3.10571411539548E-4
osteosarcoma 7933 8.41423889312782E-4
group 4 medulloblastoma 1875 0.00106242727136415
glioblastoma 5572 0.0017636757645982
subependymal giant cell astrocytoma 2287 0.00241285080347973
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00313531832121965
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00371140731163713
primary Sjogren syndrome 789 0.0038481866663587
gastric cancer 436 0.014394252273819
Multiple myeloma 1328 0.0223149549106618
mucosa-associated lymphoid tissue lymphoma 480 0.0408277418996924
Disease Target Count Z-score Confidence
Endometritis 21 3.07 1.5

Expression

Synonym

Accession Q9H223 Q9HAR1 Q9NZN2
Symbols PAST4

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
24019528 evidence that the functions of both EHD1 and EHD4 are primarily in TRE membrane vesiculation, whereas EHD3 is a membrane-tubulating protein.
23325686 Ezrin and EHD4 appear to be involved in the ability of Nef to increase hiv-1 virus infectivity.
23325686 Knockdown of EHD4 by siRNA induces decreased levels of nef-deleted HIV-1 infectivity and decreases the ability of HIV-1 Nef to increase virus infectivity
21187387 Retrograde signaling through Pincher-generated Trk-multivesicular bodies is distinctively refractory to signal termination by lysosomal processing
20489164 A new class of cardiac trafficking proteins(EHD1, EHD2, EHD3, EHD4) regulates cardiac membrane protein targeting.
18331452 EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

AA Sequence

MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQY      1 - 70
STGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFM     71 - 140
CSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAF    141 - 210
RGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQD    211 - 280
LFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQ    281 - 350
ISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGT    351 - 420
TEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKL    421 - 490
ADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKAD                       491 - 541
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019528 2013 Differential roles of C-terminal Eps15 homology domain proteins as vesiculators and tubulators of recycling endosomes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23325686 2013 Comparative proteomic analysis of HIV-1 particles reveals a role for Ezrin and EHD4 in the Nef-dependent increase of virus infectivity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21187387 2011 Trk retrograde signaling requires persistent, Pincher-directed endosomes.
More...