Property Summary

NCBI Gene PubMed Count 22
PubMed Score 15.93
PubTator Score 211.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Astrocytoma, Pilocytic 1.800 8.0e-08
gastric cancer -1.300 1.4e-02
glioblastoma 1.700 1.8e-03
group 4 medulloblastoma -1.300 1.1e-03
hepatocellular carcinoma -1.400 7.7e-05
intraductal papillary-mucinous adenoma (... -1.100 3.1e-03
intraductal papillary-mucinous neoplasm ... 1.400 3.7e-03
juvenile dermatomyositis 1.020 5.4e-10
mucosa-associated lymphoid tissue lympho... 1.083 4.1e-02
Multiple myeloma 1.196 2.2e-02
osteosarcoma -2.120 8.4e-04
ovarian cancer 2.100 1.0e-04
primary Sjogren syndrome 1.100 3.8e-03
subependymal giant cell astrocytoma 1.668 1.6e-02
tuberculosis -1.100 3.1e-04

Gene RIF (6)

AA Sequence

MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQY      1 - 70
STGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFM     71 - 140
CSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAF    141 - 210
RGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQD    211 - 280
LFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQ    281 - 350
ISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGT    351 - 420
TEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKL    421 - 490
ADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKAD                       491 - 541
//

Text Mined References (29)

PMID Year Title