Property Summary

NCBI Gene PubMed Count 106
PubMed Score 155.11
PubTator Score 127.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.009 1.4e-03
pancreatic ductal adenocarcinoma liver m... -1.595 6.1e-04
psoriasis -1.200 4.1e-04

Protein-protein Interaction (6)

Gene RIF (119)

AA Sequence

MAGKAAEERGLPKGATPQDTSGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLASQVPWFEQLAQ      1 - 70
FKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSS     71 - 140
PQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFSQAQRDKRVEDVIAELRLRQCADTRVGNMYV    141 - 210
RGLSGGERRRVSIGVQLLWNPGILILDEPTSGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLF    211 - 280
DLVLLMTSGTPIYLGAAQHMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFL    281 - 350
EKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLPTLLIH    351 - 420
GAEACLMSMTIGFLYFGHGSIQLSFMDTAALLFMIGALIPFNVILDVISKCYSERAMLYYELEDGLYTTG    421 - 490
PYFFAKILGELPEHCAYIIIYGMPTYWLANLRPGLQPFLLHFLLVWLVVFCCRIMALAAAALLPTFHMAS    491 - 560
FFSNALYNSFYLAGGFMINLSSLWTVPAWISKVSFLRWCFEGLMKIQFSRRTYKMPLGNLTIAVSGDKIL    561 - 630
SVMELDSYPLYAIYLIVIGLSGGFMVLYYVSLRFIKQKPSQDW                               631 - 673
//

Text Mined References (108)

PMID Year Title