Property Summary

NCBI Gene PubMed Count 17
PubMed Score 107.64
PubTator Score 157.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (3)

AA Sequence

MPRGRKSRRRRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASS      1 - 70
TAQAQKPSVPRSNFQGTKKSLLMSILALIFIMGNSAKEALVWKVLGKLGMQPGRQHSIFGDPKKIVTEEF     71 - 140
VRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILN    141 - 210
SGARGYSAP                                                                 211 - 219
//

Text Mined References (18)

PMID Year Title