Property Summary

NCBI Gene PubMed Count 17
PubMed Score 107.64
PubTator Score 157.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q9H213 B2R8V9 Q5JRJ3 Q9Y5M2
Symbols APR1
APR-1
MAGEH

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MPRGRKSRRRRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASS      1 - 70
TAQAQKPSVPRSNFQGTKKSLLMSILALIFIMGNSAKEALVWKVLGKLGMQPGRQHSIFGDPKKIVTEEF     71 - 140
VRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILN    141 - 210
SGARGYSAP                                                                 211 - 219
//

Text Mined References (18)

PMID Year Title