Property Summary

NCBI Gene PubMed Count 17
Grant Count 16
R01 Count 4
Funding $1,184,316.5
PubMed Score 84.68
PubTator Score 157.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26572808 our data showed that Apr-1 plays a crucial role in cell proliferation by controlling cell cycle progression, implying a tumor-suppressor function of Apr-1 in cholangiocarcinoma carcinogenesis
25366798 Data indicate that the neonatal detection test sensitivity obtained was 95% with a positive predictive value of 1 in the analyses for both the arylsulfatase E (ARSE) and melanoma antigen family H1 (MAGEH1) genes.
21418516 The induction of APR-1 expression caused apoptosis of melanoma cells via the interaction with the juxtamembrane region of p75 neurotrophin receptor.

AA Sequence

MPRGRKSRRRRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASS      1 - 70
TAQAQKPSVPRSNFQGTKKSLLMSILALIFIMGNSAKEALVWKVLGKLGMQPGRQHSIFGDPKKIVTEEF     71 - 140
VRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILN    141 - 210
SGARGYSAP                                                                 211 - 219
//

Text Mined References (18)

PMID Year Title
26572808 2016 Apoptosis-related protein-1 acts as a tumor suppressor in cholangiocarcinoma cells by inducing cell cycle arrest via downregulation of cyclin-dependent kinase subunits.
25416956 2014 A proteome-scale map of the human interactome network.
25366798 2014 Neonatal detection of Turner syndrome by real-time PCR gene quantification of the ARSE and MAGEH1 genes.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
21418516 2012 Apoptosis related protein-1 triggers melanoma cell death via interaction with the juxtamembrane region of p75 neurotrophin receptor.
20088962 2010 Establishment of six new human biliary tract carcinoma cell lines and identification of MAGEH1 as a candidate biomarker for predicting the efficacy of gemcitabine treatment.
18759029 2002 Cloning and biological comparison of Restin, novel member of Mage superfamily.
16574066 2006 Transcriptional up-regulation of restin by all-trans retinoic acid through STAT1 in cancer cell differentiation process.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
More...