Property Summary

NCBI Gene PubMed Count 5
PubMed Score 8.71
PubTator Score 1.86

Knowledge Summary

Patent (10,646)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MMWENWTIVSEFVLVSFSALSTELQALLFLLFLTIYLVTLMGNVLIILVTIADSALQSPMYFFLRNLSFL      1 - 70
EIGFNLVIVPKMLGTLIIQDTTISFLGCATQMYFFFFFGAAECCLLATMAYDRYVAICDPLHYPVIMGHI     71 - 140
SCAQLAAASWFSGFSVATVQTTWIFSFPFCGPNRVNHFFCDSPPVIALVCADTSVFELEALTATVLFILF    141 - 210
PFLLILGSYVRILSTIFRMPSAEGKHQAFSTCSAHLLVVSLFYSTAILTYFRPQSSASSESKKLLSLSST    211 - 280
VVTPMLNPIIYSSRNKEVKAALKRLIHRTLGSQKL                                       281 - 315
//

Text Mined References (7)

PMID Year Title