Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent (3,297)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Gene RIF (1)

AA Sequence

MSFSSLPTEIQSLLFLTFLTIYLVTLMGNCLIILVTLADPMLHSPMYFFLRNLSFLEIGFNLVIVPKMLG      1 - 70
TLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMAYDRYVAICSPLHYPVIMNQRTRAKLAAASWFPGF     71 - 140
PVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLRLVCADTALFEIYAIVGTILVVMIPCLLILCSYTHIAA    141 - 210
AILKIPSAKGKNKAFSTCSSHLLVVSLFYISLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSLR    211 - 280
NNEVKNALSRTVSKALALRNCIP                                                   281 - 303
//

Text Mined References (7)

PMID Year Title