Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.32
PubTator Score 2.00

Knowledge Summary

Patent (3,359)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hereditary hemorrhagic telangiectasia 13 5.043 2.5
Telangiectasis 36 4.677 2.3

Gene RIF (2)

AA Sequence

MELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITMEARLHMPMYLLLGQLSLMD      1 - 70
LLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAYDRYVAICHPLTYMTLMSSRA     71 - 140
CWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCEIPHLLKVACADTSRYELMVYVMGVTFLIPS    141 - 210
LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTI    211 - 280
VTPALNPLIYSLRNKEVMRALRRVLGKYMLPAHSTL                                      281 - 316
//

Text Mined References (10)

PMID Year Title