Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
R01 Count 1
Funding $57,461
PubMed Score 6.32
PubTator Score 2.00

Knowledge Summary

Patent (3,359)

TINX Plot

  Disease Relevance (2)

Gene RIF (2)

PMID Text
17005854 OR2AG1 binds beta-arrestin2 with high affinity and is internalized via a clathrin-dependent mechanism.
16565291 The Hsc70t helps expression of OR2AG1 in heterologous cell systems and helped the characterization of an "orphan" human olfactory receptor.

AA Sequence

MELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITMEARLHMPMYLLLGQLSLMD      1 - 70
LLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAYDRYVAICHPLTYMTLMSSRA     71 - 140
CWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCEIPHLLKVACADTSRYELMVYVMGVTFLIPS    141 - 210
LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTI    211 - 280
VTPALNPLIYSLRNKEVMRALRRVLGKYMLPAHSTL                                      281 - 316
//

Text Mined References (10)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
19909339 2009 Olfactory receptor signaling is regulated by the post-synaptic density 95, Drosophila discs large, zona-occludens 1 (PDZ) scaffold multi-PDZ domain protein 1.
17005854 2006 Beta-arrestin2-mediated internalization of mammalian odorant receptors.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
16565291 2006 A specific heat shock protein enhances the expression of mammalian olfactory receptor proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11416212 2001 Genomic analysis of orthologous mouse and human olfactory receptor loci.