Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.32
PubTator Score 2.00

Knowledge Summary

Patent (3,359)

TINX Plot

  Disease Sources (1)

Synonym

Accession Q9H205 B9EKV7 Q6IFG7 Q96R26
Symbols OR2AG3
OR11-79

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Rat OMA Inparanoid
Rat OMA EggNOG
Horse OMA EggNOG
Horse OMA Inparanoid
Cow OMA EggNOG

Gene RIF (2)

PMID Text
17005854 OR2AG1 binds beta-arrestin2 with high affinity and is internalized via a clathrin-dependent mechanism.
16565291 The Hsc70t helps expression of OR2AG1 in heterologous cell systems and helped the characterization of an "orphan" human olfactory receptor.

AA Sequence

MELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITMEARLHMPMYLLLGQLSLMD      1 - 70
LLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAYDRYVAICHPLTYMTLMSSRA     71 - 140
CWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCEIPHLLKVACADTSRYELMVYVMGVTFLIPS    141 - 210
LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTI    211 - 280
VTPALNPLIYSLRNKEVMRALRRVLGKYMLPAHSTL                                      281 - 316
//

Text Mined References (10)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
19909339 2009 Olfactory receptor signaling is regulated by the post-synaptic density 95, Drosophila discs large, zona-occludens 1 (PDZ) scaffold multi-PDZ domain protein 1.
17005854 2006 Beta-arrestin2-mediated internalization of mammalian odorant receptors.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
16565291 2006 A specific heat shock protein enhances the expression of mammalian olfactory receptor proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11416212 2001 Genomic analysis of orthologous mouse and human olfactory receptor loci.