Property Summary

NCBI Gene PubMed Count 26
PubMed Score 173.53
PubTator Score 81.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.119 9.5e-05
adult high grade glioma -1.200 1.3e-03
atypical teratoid / rhabdoid tumor 1.400 5.7e-07
glioblastoma 1.400 1.9e-02
group 3 medulloblastoma 2.000 9.1e-05
lung cancer 1.400 4.9e-04
medulloblastoma, large-cell 1.400 8.3e-05
Multiple myeloma 1.062 8.0e-03
osteosarcoma -1.407 4.3e-04
ovarian cancer -1.200 1.2e-06
Pick disease 1.100 2.3e-04
Waldenstrons macroglobulinemia 1.007 3.1e-03

Gene RIF (16)

AA Sequence

MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQ      1 - 70
EEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQ     71 - 140
QVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT                                    141 - 178
//

Text Mined References (28)

PMID Year Title