Property Summary

NCBI Gene PubMed Count 25
Grant Count 20
R01 Count 13
Funding $2,882,834.59
PubMed Score 171.05
PubTator Score 81.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.007 0.003
Multiple myeloma 1.062 0.008
osteosarcoma -2.265 0.000
group 3 medulloblastoma 2.000 0.000
glioblastoma 1.400 0.019
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.400 0.000
acute quadriplegic myopathy 1.119 0.000
lung cancer 1.400 0.000
adult high grade glioma -1.200 0.001
Pick disease 1.100 0.000
ovarian cancer 1.300 0.005

Gene RIF (15)

PMID Text
26660958 All trans-retinoic acid can reverse the suppressive effect of MED28 on HBP1 and E-cadherin and inactivate the Wnt/beta-catenin pathway in colorectal cancer, suggesting a protective effect of ATRA against colorectal cancer.
25100719 Knockdown of mediator complex subunit 28 (MED28) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
23950709 This paper describes a link between Med23 and IFN-lambda3, provides evidence for the crucial role of IFN-lambda in HSV-1 immune control.
22495818 These data indicate that MED28 regulates cellular migration in a MEK1-dependent manner in human breast cancer cells, reinforcing the important cellular roles of MED28.
20584319 High MED28 is associated with breast cancer.
18976975 Knockdown of MED28 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 28 (MED28) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of MED28 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18187620 Knockdown of mediator complex subunit 28 (MED28) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17848560 Study reports that down-regulation of human Med28 expression in NIH3T3 cells results in a significant induction of several genes associated with smooth muscle cell (SMC)differentiation; conversely, overexpression of MED28 represses SMC gene expression.
More...

AA Sequence

MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQ      1 - 70
EEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQ     71 - 140
QVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT                                    141 - 178
//

Text Mined References (27)

PMID Year Title
26660958 2016 All Trans-Retinoic Acid Mediates MED28/HMG Box-Containing Protein 1 (HBP1)/?-Catenin Signaling in Human Colorectal Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
23950709 2013 A systematic analysis of host factors reveals a Med23-interferon-? regulatory axis against herpes simplex virus type 1 replication.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22495818 2012 MED28 regulates MEK1-dependent cellular migration in human breast cancer cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20584319 2010 Elevated MED28 expression predicts poor outcome in women with breast cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...