Property Summary

NCBI Gene PubMed Count 10
Grant Count 2
Funding $110,292
PubMed Score 7.64
PubTator Score 3.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 0.000

Synonym

Accession Q9H201 A8K6J3 A8KAB2 Q9BVN6 Q9NWK2
Symbols

Gene

 Grant Application (2)

 GO Function (1)

AA Sequence

MTTSALRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFTEVMGMLWRRLNDSGKN      1 - 70
WRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERL     71 - 140
RQERTHALKTKERMALEGIGIGSGQLGFSRRYGEDYSRSRGSPSSYNSSSSSPRYTSDLEQARPQTSGEE    141 - 210
ELQLQLALAMSREEAEKPVPPASHRDEDLQLQLALRLSRQEHEKEVRSWQGDGSPMANGAGAVVHHQRDR    211 - 280
EPEREERKEEEKLKTSQSSILDLADIFVPALAPPSTHCSADPWDIPGFRPNTEASGSSWGPSADPWSPIP    281 - 350
SGTVLSRSQPWDLTPMLSSSEPWGRTPVLPAGPPTTDPWALNSPHHKLPSTGADPWGASLETSDTPGGAS    351 - 420
TFDPFAKPPESTETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGILGEALTQPSKEA    421 - 490
RACRTPESFLGPSASSLVNLDSLVKAPQVAKTRNPFLTGLSAPSPTNPFGAGEPGRPTLNQMRTGSPALG    491 - 560
LAGGPVGAPLGSMTYSASLPLPLSSVPAGLTLPASVSVFPQAGAFAPQPLLPTPSSAGPRPPPPQTGTNP    561 - 630
FL                                                                        631 - 632
//

Text Mined References (10)

PMID Year Title
20709745 2010 The epsin family of endocytic adaptors promotes fibrosarcoma migration and invasion.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11359770 2001 Epsin 3 is a novel extracellular matrix-induced transcript specific to wounded epithelia.
10951261 2000 Cloning and initial characterization of human epsin 3, a novel matrix-induced keratinocyte specific transcript
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.