Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.64
PubTator Score 3.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.38016708868775E-47

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 0.000

Synonym

Accession Q9H201 A8K6J3 A8KAB2 Q9BVN6 Q9NWK2
Symbols

Gene

  Ortholog (12)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid
C. elegans OMA Inparanoid

 GO Function (1)

AA Sequence

MTTSALRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFTEVMGMLWRRLNDSGKN      1 - 70
WRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERL     71 - 140
RQERTHALKTKERMALEGIGIGSGQLGFSRRYGEDYSRSRGSPSSYNSSSSSPRYTSDLEQARPQTSGEE    141 - 210
ELQLQLALAMSREEAEKPVPPASHRDEDLQLQLALRLSRQEHEKEVRSWQGDGSPMANGAGAVVHHQRDR    211 - 280
EPEREERKEEEKLKTSQSSILDLADIFVPALAPPSTHCSADPWDIPGFRPNTEASGSSWGPSADPWSPIP    281 - 350
SGTVLSRSQPWDLTPMLSSSEPWGRTPVLPAGPPTTDPWALNSPHHKLPSTGADPWGASLETSDTPGGAS    351 - 420
TFDPFAKPPESTETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGILGEALTQPSKEA    421 - 490
RACRTPESFLGPSASSLVNLDSLVKAPQVAKTRNPFLTGLSAPSPTNPFGAGEPGRPTLNQMRTGSPALG    491 - 560
LAGGPVGAPLGSMTYSASLPLPLSSVPAGLTLPASVSVFPQAGAFAPQPLLPTPSSAGPRPPPPQTGTNP    561 - 630
FL                                                                        631 - 632
//

Text Mined References (10)

PMID Year Title
20709745 2010 The epsin family of endocytic adaptors promotes fibrosarcoma migration and invasion.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11359770 2001 Epsin 3 is a novel extracellular matrix-induced transcript specific to wounded epithelia.
10951261 2000 Cloning and initial characterization of human epsin 3, a novel matrix-induced keratinocyte specific transcript
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.