Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 1.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.4e-05
atypical teratoid / rhabdoid tumor 5112 1.4e-03

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.4e-03
ovarian cancer 1.100 5.4e-05

AA Sequence

MEEGERSPLLSQETAGQKPLSVHRPPTSGCLGPVPREDQAEAWGCSCCPPETKHQALSGTPKKGPAPSLS      1 - 70
PGSSCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPTDPMLGLALGGLVVSAASLAGCL     71 - 140
GALCENTCLLRGFSGGILAFLVLEAVAGALVVALWGPLQDSLEHTLRVAIAHYQDDPDLRFLLDQVQLGL    141 - 210
RCCGAASYQDWQQNLYFNCSSPGVQACSLPASCCIDPREDGASVNDQCGFGVLRLDADAAQRVVYLEGCG    211 - 280
PPLRRWLRANLAASGGYAIAVVLLQGAELLLAARLLGALAARSGAAYGPGAHGEDRAGPQSPSPGAPPAA    281 - 350
KPARG                                                                     351 - 355
//

Text Mined References (7)

PMID Year Title