Property Summary

NCBI Gene PubMed Count 13
PubMed Score 35.48
PubTator Score 13.80

Knowledge Summary

Patent (2,878)

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma -1.300 9.5e-03
aldosterone-producing adenoma -1.178 1.5e-02
astrocytic glioma -2.200 2.0e-03
Astrocytoma, Pilocytic -1.300 5.3e-04
atypical teratoid / rhabdoid tumor -1.200 3.7e-02
breast carcinoma 1.100 2.4e-15
Down syndrome -1.100 1.1e-02
ductal carcinoma in situ 1.800 4.2e-05
ependymoma -1.900 2.4e-02
glioblastoma -1.300 8.1e-04
group 4 medulloblastoma -1.900 8.8e-04
intraductal papillary-mucinous carcinoma... 1.200 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.600 1.7e-02
invasive ductal carcinoma 1.800 4.6e-02
lung carcinoma -1.800 1.1e-19
malignant mesothelioma -1.800 2.1e-07
medulloblastoma, large-cell -1.500 3.7e-02
oligodendroglioma -2.100 7.1e-03
ovarian cancer 1.800 2.0e-04
pancreatic cancer 1.200 1.2e-04
Pick disease -1.200 1.6e-02
pituitary cancer -1.200 3.0e-02
primitive neuroectodermal tumor -1.100 3.5e-02
psoriasis -1.100 1.6e-03
ulcerative colitis -1.500 1.0e-04
Waldenstrons macroglobulinemia -2.037 2.5e-04
X-linked cerebral adrenoleukodystrophy -1.200 3.7e-02

Gene RIF (7)

AA Sequence

MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQ      1 - 70
RLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERY     71 - 140
IRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGC    141 - 210
LVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVN    211 - 280
GHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPI    281 - 350
VMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL                      351 - 402
//

Text Mined References (13)

PMID Year Title