Property Summary

NCBI Gene PubMed Count 13
Grant Count 3
R01 Count 3
Funding $4,026,725.33
PubMed Score 32.22
PubTator Score 13.80

Knowledge Summary

Patent (2,878)

Expression

  Differential Expression (27)

Synonym

Accession Q9H1Y3 Q8IX08 Q9Y344
Symbols ECPN
PPP1R116

Gene

PANTHER Protein Class (2)

  TechDev Info (2)

Bryan Roth functional assay
Steve Finkbeiner Neuron specific phenotypes being screened

Gene RIF (7)

PMID Text
22313545 Decreased OPN3 levels in Bel7402(5-FU) cells activated the anti-apoptotic pathway through increasing phospho-Akt and the Bcl2/Bax ratio, while overexpression of OPN3 inactivated this pathway.
19626040 Observational study of gene-disease association. (HuGE Navigator)
18344558 Polymorphisms in the OPN3 and CHML genes are associated with asthma and atopic asthma.
18344558 Observational study of gene-disease association. (HuGE Navigator)
14623461 Related persons with heterozygous germline deletions of 1q42.3, which includes EXO1, RGS7, KMO, CHML, and OPN3, showed no phenotypic abnormalities other than multiple leiomyomatosis.
12242008 Human OPN3 gene consists of six exons and expresses various splice variants.
12063405 Assignment of panopsin (OPN3) to human chromosome band 1q43

AA Sequence

MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQ      1 - 70
RLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERY     71 - 140
IRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGC    141 - 210
LVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVN    211 - 280
GHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPI    281 - 350
VMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL                      351 - 402
//

Text Mined References (13)

PMID Year Title
22313545 2012 Opsin3 sensitizes hepatocellular carcinoma cells to 5-fluorouracil treatment by regulating the apoptotic pathway.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
18344558 2008 Identification of a novel asthma susceptibility gene on chromosome 1qter and its functional evaluation.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14623461 2003 Germline deletions of EXO1 do not cause colorectal tumors and lesions which are null for EXO1 do not have microsatellite instability.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242008 2002 Different structural organization of the encephalopsin gene in man and mouse.
12063405 2001 Assignment of panopsin (OPN3) to human chromosome band 1q43 by in situ hybridization and somatic cell hybrids.
More...