Property Summary

NCBI Gene PubMed Count 95
Grant Count 134
R01 Count 79
Funding $14,170,468.75
PubMed Score 559.71
PubTator Score 311.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 0.000
psoriasis -1.200 0.000
osteosarcoma 1.551 0.002
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.600 0.000
medulloblastoma -1.300 0.001
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.100 0.006
lung cancer -1.600 0.004
ovarian cancer -1.900 0.000

Synonym

Accession Q9H1Y0 O60875 Q5JVR2 Q68DI4 Q9H2B8 Q9HCZ7
Symbols ASP
APG5
APG5L
hAPG5
APG5-LIKE

Gene

PDB

4GDK   4GDL   4NAW   4TQ0   4TQ1   5D7G  

Gene RIF (64)

PMID Text
26747760 This study demonstrated an association of ATG5 rs573775 with BD and ATG10 rs4703863 with VKH syndrome in a Chinese Han population.
26509176 study established a relationship between trans-eSNPs of ATG5 and lupus nephritis in a northern Han population from China
26282792 KIM-1-/TIM-1-mediated phagocytosis links ATG5-/ULK1-dependent clearance of apoptotic cells to antigen presentation.
26240015 in the presence of 3-MA and Atg5 siRNA, autophagy was inhibited, LC3-II expression decreased and cell apoptosis increased
26039132 Increased frequencies of rare variants of ATG5 were identified in patients with LN and Systemic Lupus Erythematosus compared with healthy controls, highlighting a likely important role of rare ATG5 variants in Chinese SLE patients.
25787994 provide an insight into a model for swapping ATG5 partners for autophagosome maturation
25484072 the crystal structures of human ATG5 in complex with an N-terminal domain of ATG16L1 as well as an internal AIR domain of TECPR1, are reported.
25481044 Taken together, the results demonstrate that ATG5 cleavage provokes apoptosis and represents a molecular link between autophagy and apoptosis
25439980 Analysis of hepatitis B virus capsid maturation steps revealed that Rab33B and Atg5/12/16L1 are required for proper particle assembly and/or stability.
25329677 Increased expression of ATG5 was significantly correlated with poor overall survival and chemoresistance in gastric cancer.
More...

AA Sequence

MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWF      1 - 70
EYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQ     71 - 140
VINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADG    141 - 210
QLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD         211 - 275
//

Text Mined References (101)

PMID Year Title
26747760 2015 Association of ATG5 Gene Polymorphisms With Behçet's Disease and ATG10 Gene Polymorphisms With VKH Syndrome in a Chinese Han Population.
26509176 2015 Detecting Genetic Associations between ATG5 and Lupus Nephritis by trans-eQTL.
26282792 2015 KIM-1-/TIM-1-mediated phagocytosis links ATG5-/ULK1-dependent clearance of apoptotic cells to antigen presentation.
26240015 2015 Atg5 siRNA inhibits autophagy and enhances norcantharidin-induced apoptosis in hepatocellular carcinoma.
26039132 2015 Rare Variants of ATG5 Are Likely to Be Associated With Chinese Patients With Systemic Lupus Erythematosus.
25787994 2015 Swapping of interaction partners with ATG5 for autophagosome maturation.
25484072 2015 Insights into autophagosome maturation revealed by the structures of ATG5 with its interacting partners.
25481044 2014 Bortezomib induces AMPK-dependent autophagosome formation uncoupled from apoptosis in drug resistant cells.
25439980 2015 Rab33B and its autophagic Atg5/12/16L1 effector assist in hepatitis B virus naked capsid formation and release.
25329677 2014 Upregulation of autophagy-related gene-5 (ATG-5) is associated with chemoresistance in human gastric cancer.
More...