Property Summary

NCBI Gene PubMed Count 118
PubMed Score 656.21
PubTator Score 311.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 4.5e-06
gastric cancer 1.100 3.8e-04
glioblastoma -1.600 3.2e-04
group 4 medulloblastoma -1.100 1.1e-02
lung cancer -1.600 3.7e-03
medulloblastoma, large-cell -2.700 8.6e-07
osteosarcoma -1.142 2.8e-02
ovarian cancer -1.900 8.9e-06
primitive neuroectodermal tumor -1.100 5.9e-03
psoriasis -1.200 1.1e-07

Protein-protein Interaction (1)

Gene RIF (83)

AA Sequence

MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWF      1 - 70
EYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQ     71 - 140
VINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADG    141 - 210
QLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD         211 - 275
//

Text Mined References (124)

PMID Year Title