Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.29
PubTator Score 4.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.800 2.6e-06
group 3 medulloblastoma -1.200 8.9e-03
medulloblastoma, large-cell -1.400 1.8e-03
nasopharyngeal carcinoma -2.000 3.8e-08

Gene RIF (2)

AA Sequence

MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAP      1 - 70
RKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRL     71 - 140
VSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPS    141 - 210
LDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML        211 - 276
//

Text Mined References (9)

PMID Year Title