Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.37
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.600 7.4e-05
astrocytoma -1.300 3.0e-29
Astrocytoma, Pilocytic -1.900 5.0e-10
atypical teratoid / rhabdoid tumor -1.700 8.8e-09
ependymoma -1.900 1.6e-18
glioblastoma -1.800 3.7e-12
group 3 medulloblastoma -1.900 1.9e-04
lung carcinoma 4.800 9.6e-62
medulloblastoma, large-cell -1.100 1.0e-04
oligodendroglioma -1.400 2.5e-22
osteosarcoma 1.502 2.5e-08
ovarian cancer -1.200 4.3e-06
primitive neuroectodermal tumor -1.500 4.7e-06

Gene RIF (3)

AA Sequence

MPKNSKVTQREHSSEHVTESVADLLALEEPVDYKQSVLNVAGEAGGKQKAVEEELDAEDRPAWNSKLQYI      1 - 70
LAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLVLLIIIGIPLFFLELAVGQRIRRGSIGVWHYICPRLG     71 - 140
GIGFSSCIVCLFVGLYYNVIIGWSIFYFFKSFQYPLPWSECPVVRNGSVAVVEAECEKSSATTYFWYREA    141 - 210
LDISDSISESGGLNWKMTLCLLVAWSIVGMAVVKGIQSSGKVMYFSSLFPYVVLACFLVRGLLLRGAVDG    211 - 280
ILHMFTPKLDKMLDPQVWREAATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSFINFFTSVLATLV    281 - 350
VFAVLGFKANIMNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSAL    351 - 420
GLDPCLLEDELDKSVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMIGTMAGITTPIIDTFK    421 - 490
VPKEMFTVGCCVFAFLVGLLFVQRSGNYFVTMFDDYSATLPLTLIVILENIAVAWIYGTKKFMQELTEML    491 - 560
GFRPYRFYFYMWKFVSPLCMAVLTTASIIQLGVTPPGYSAWIKEEAAERYLYFPNWAMALLITLIVVATL    561 - 630
PIPVVFVLRHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGST    631 - 700
SPLETSGNPNGRYGSGYLLASTPESEL                                               701 - 727
//

Text Mined References (12)

PMID Year Title