Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.54
PubTator Score 1.04

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H1U9
Symbols CG7943
MCART1

Gene

Gene RIF (2)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAIL      1 - 70
QLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGVAAVLAGTTEAIFTPLER     71 - 140
VQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAH    141 - 210
LVNDFICGGLLGAMLGFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSL    211 - 280
ISWGIINATYEFLLKVI                                                         281 - 297
//

Text Mined References (9)

PMID Year Title
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.