Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.32
PubTator Score 2.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.400 3.4e-05
astrocytic glioma -1.200 2.9e-02
atypical teratoid / rhabdoid tumor -1.400 1.3e-03
axial spondyloarthropathy 1.300 2.3e-02
chronic lymphosyte leukemia -1.100 4.0e-07
cutaneous lupus erythematosus -1.100 7.2e-04
glioblastoma -1.100 1.2e-04
lung cancer -1.700 2.2e-02
medulloblastoma, large-cell -1.900 2.2e-04
osteosarcoma -1.371 4.7e-02
ovarian cancer -1.800 1.1e-10
pancreatic ductal adenocarcinoma liver m... -2.228 1.1e-03
psoriasis -3.500 1.2e-05
Rheumatoid arthritis 1.900 5.4e-04
tuberculosis 2.500 2.1e-05

Gene RIF (1)

AA Sequence

MNGGAERAMRSLPSLGGLALLCCAAAAAAAAVASAASAGNVTGGGGAAGQVDASPGPGLRGEPSHPFPRA      1 - 70
TAPTAQAPRTGPPRATVHRPLAATSPAQSPETTPLWATAGPSSTTFQAPLGPSPTTPPAAERTSTTSQAP     71 - 140
TRPAPTTLSTTTGPAPTTPVATTVPAPTTPRTPTPDLPSSSNSSVLPTPPATEAPSSPPPEYVCNCSVVG    141 - 210
SLNVNRCNQTTGQCECRPGYQGLHCETCKEGFYLNYTSGLCQPCDCSPHGALSIPCNSSGKCQCKVGVIG    211 - 280
SICDRCQDGYYGFSKNGCLPCQCNNRSASCDALTGACLNCQENSKGNHCEECKEGFYQSPDATKECLRCP    281 - 350
CSAVTSTGSCSIKSSELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESG    351 - 420
ECINCLHNTTGFWCENCLEGYVHDLEGNCIKKEVILPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQ    421 - 490
TIFSVSTSENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKEDNI    491 - 560
SFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA                                561 - 602
//

Text Mined References (8)

PMID Year Title