Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.32
PubTator Score 2.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.07346279124496E-10
chronic lymphosyte leukemia 232 4.0363864056275E-7
tuberculosis 1563 1.86720396858821E-6
psoriasis 6685 1.23914072566164E-5
adult high grade glioma 2148 3.40660273895175E-5
medulloblastoma, large-cell 6234 2.23192063060631E-4
Rheumatoid Arthritis 1171 5.39465494248345E-4
osteosarcoma 7933 6.79209570352315E-4
cutaneous lupus erythematosus 1056 7.15221750904041E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00105767192372214
lung cancer 4473 0.00120370266849142
atypical teratoid / rhabdoid tumor 4369 0.00127481828969566
glioblastoma 5572 0.00747426199413411
axial spondyloarthropathy 28 0.0234632417196912
astrocytic glioma 2241 0.0287842257841092
Disease Target Count Z-score Confidence
Smoldering myeloma 1 4.181 2.1

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.001
astrocytic glioma -1.200 0.029
cutaneous lupus erythematosus -1.100 0.001
psoriasis -3.500 0.000
osteosarcoma -2.238 0.001
chronic lymphosyte leukemia -1.100 0.000
glioblastoma -1.300 0.007
atypical teratoid / rhabdoid tumor -1.400 0.001
medulloblastoma, large-cell -1.900 0.000
tuberculosis 2.600 0.000
pancreatic ductal adenocarcinoma liver m... -2.228 0.001
lung cancer -2.000 0.001
adult high grade glioma -1.400 0.000
ovarian cancer -1.800 0.000
axial spondyloarthropathy 1.300 0.023

Synonym

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
24098452 miR-125b acts as a tumor suppressor in breast tumorigenesis via its novel direct targets ENPEP, CK2-alpha, CCNJ, and MEGF9.

AA Sequence

MNGGAERAMRSLPSLGGLALLCCAAAAAAAAVASAASAGNVTGGGGAAGQVDASPGPGLRGEPSHPFPRA      1 - 70
TAPTAQAPRTGPPRATVHRPLAATSPAQSPETTPLWATAGPSSTTFQAPLGPSPTTPPAAERTSTTSQAP     71 - 140
TRPAPTTLSTTTGPAPTTPVATTVPAPTTPRTPTPDLPSSSNSSVLPTPPATEAPSSPPPEYVCNCSVVG    141 - 210
SLNVNRCNQTTGQCECRPGYQGLHCETCKEGFYLNYTSGLCQPCDCSPHGALSIPCNSSGKCQCKVGVIG    211 - 280
SICDRCQDGYYGFSKNGCLPCQCNNRSASCDALTGACLNCQENSKGNHCEECKEGFYQSPDATKECLRCP    281 - 350
CSAVTSTGSCSIKSSELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESG    351 - 420
ECINCLHNTTGFWCENCLEGYVHDLEGNCIKKEVILPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQ    421 - 490
TIFSVSTSENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKEDNI    491 - 560
SFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA                                561 - 602
//

Text Mined References (8)

PMID Year Title
24098452 2013 miR-125b acts as a tumor suppressor in breast tumorigenesis via its novel direct targets ENPEP, CK2-?, CCNJ, and MEGF9.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9693030 1998 Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.