Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.32
PubTator Score 2.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.001
astrocytic glioma -1.200 0.029
cutaneous lupus erythematosus -1.100 0.001
psoriasis -3.500 0.000
osteosarcoma -2.238 0.001
chronic lymphosyte leukemia -1.100 0.000
glioblastoma -1.300 0.007
atypical teratoid / rhabdoid tumor -1.400 0.001
medulloblastoma, large-cell -1.900 0.000
tuberculosis 2.600 0.000
pancreatic ductal adenocarcinoma liver m... -2.228 0.001
lung cancer -2.000 0.001
adult high grade glioma -1.400 0.000
ovarian cancer -1.800 0.000
axial spondyloarthropathy 1.300 0.023

Gene RIF (1)

PMID Text
24098452 miR-125b acts as a tumor suppressor in breast tumorigenesis via its novel direct targets ENPEP, CK2-alpha, CCNJ, and MEGF9.

AA Sequence

MNGGAERAMRSLPSLGGLALLCCAAAAAAAAVASAASAGNVTGGGGAAGQVDASPGPGLRGEPSHPFPRA      1 - 70
TAPTAQAPRTGPPRATVHRPLAATSPAQSPETTPLWATAGPSSTTFQAPLGPSPTTPPAAERTSTTSQAP     71 - 140
TRPAPTTLSTTTGPAPTTPVATTVPAPTTPRTPTPDLPSSSNSSVLPTPPATEAPSSPPPEYVCNCSVVG    141 - 210
SLNVNRCNQTTGQCECRPGYQGLHCETCKEGFYLNYTSGLCQPCDCSPHGALSIPCNSSGKCQCKVGVIG    211 - 280
SICDRCQDGYYGFSKNGCLPCQCNNRSASCDALTGACLNCQENSKGNHCEECKEGFYQSPDATKECLRCP    281 - 350
CSAVTSTGSCSIKSSELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESG    351 - 420
ECINCLHNTTGFWCENCLEGYVHDLEGNCIKKEVILPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQ    421 - 490
TIFSVSTSENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKEDNI    491 - 560
SFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA                                561 - 602
//

Text Mined References (8)

PMID Year Title
24098452 2013 miR-125b acts as a tumor suppressor in breast tumorigenesis via its novel direct targets ENPEP, CK2-?, CCNJ, and MEGF9.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9693030 1998 Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.