Property Summary

NCBI Gene PubMed Count 14
Grant Count 203
R01 Count 129
Funding $18,485,612.91
PubMed Score 39.75
PubTator Score 13.84

Knowledge Summary

Patent (4,583)

Expression

  Differential Expression (3)

Disease log2 FC p
Duchenne muscular dystrophy -1.033 0.000
acute quadriplegic myopathy -1.057 0.001
psoriasis 1.200 0.000

Synonym

Accession Q9H1R3 Q569L1 Q96I84 MLCK2
Symbols KMLC
MLCK
MLCK2
skMLCK

Gene

PDB

2LV6   3KF9  

 MGI Term (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
19667195 Data show that that the prototypical CaM target sequence skMLCK, a fragment from skeletal muscle myosin light chain kinase, binds to CaM in a highly cooperative way, while only a lower degree of interdomain binding cooperativity emerges for CaMKK.
18976975 Knockdown of myosin light chain kinase 2 (MYLK2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18828194 MYLK gene is a risk factor for the development of acute lung injuries.
16448786 Observational study of gene-disease association. (HuGE Navigator)
16448786 These data suggest that the kinase domain of MYLK2 is rarely mutated in common human carcinomas and that it does not play a dominant role in cancer pathogenesis.
14500714 the P2X1-ERK2-Myosin Light Chain Kinase axis contributes to collagen-induced platelet activation by enhancing platelet degranulation

AA Sequence

MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASEKGDGTLAQPS      1 - 70
TSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGSQDPGKPRVGKKAAEGQAAAR     71 - 140
RGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEK    141 - 210
TPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVS    211 - 280
SEFSMNSKEALGGGKFGAVCTCMEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIE    281 - 350
TPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGH    351 - 420
LVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTET    421 - 490
LNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWLNNLAEKAKRCNRRLKSQILL    491 - 560
KKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV                                      561 - 596
//

Text Mined References (14)

PMID Year Title
21556048 2011 Skeletal myosin light chain kinase regulates skeletal myogenesis by phosphorylation of MEF2C.
19667195 2009 Single-molecule force spectroscopy distinguishes target binding modes of calmodulin.
18828194 2008 Variation in the myosin light chain kinase gene is associated with development of acute lung injury after major trauma.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16448786 2006 Mutational analysis of the kinase domain of MYLK2 gene in common human cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14500714 2003 P2X1-mediated ERK2 activation amplifies the collagen-induced platelet secretion by enhancing myosin light chain kinase activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11733062 2001 The overall pattern of cardiac contraction depends on a spatial gradient of myosin regulatory light chain phosphorylation.
More...