Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.32
PubTator Score 6.73

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H1R2 A6NH79 A8MVC8 Q5QP62 Q5QP63 Q5QP65 Q6PGN7 Q8N826 Q9BX24
Symbols VHY
C20orf57

Gene

PDB

1YZ4  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG

Gene RIF (3)

PMID Text
22792334 Dusp15/VHY is a key regulator of oligodendrocyte differentiation, and PDGFR-beta and SNX6 are novel and specific Dusp15 substrates.
16170801 crystal structure of catalytic domain
15138252 VHY is a new member of a subgroup of myristoylated VH1-like small dual specificity phosphatases

AA Sequence

MTEGVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINF      1 - 70
IHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASS     71 - 140
QKGARHRTSKTSGAQCPPMTSATCLLAARVALLSAALVREATGRTAQRCRLSPRAAAERLLGPPPHVAAG    141 - 210
WSPDPKYQICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQC    211 - 280
SCLHPKRAASSSCTR                                                           281 - 295
//

Text Mined References (12)

PMID Year Title
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
22792334 2012 Identification of VHY/Dusp15 as a regulator of oligodendrocyte differentiation through a systematic genomics approach.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16170801 2005 Crystal structure of the catalytic domain of human VHY, a dual-specificity protein phosphatase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15138252 2004 VHY, a novel myristoylated testis-restricted dual specificity protein phosphatase related to VHX.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...