Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.32
PubTator Score 6.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
22792334 Dusp15/VHY is a key regulator of oligodendrocyte differentiation, and PDGFR-beta and SNX6 are novel and specific Dusp15 substrates.
16170801 crystal structure of catalytic domain
15138252 VHY is a new member of a subgroup of myristoylated VH1-like small dual specificity phosphatases

AA Sequence

MTEGVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINF      1 - 70
IHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASS     71 - 140
QKGARHRTSKTSGAQCPPMTSATCLLAARVALLSAALVREATGRTAQRCRLSPRAAAERLLGPPPHVAAG    141 - 210
WSPDPKYQICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQC    211 - 280
SCLHPKRAASSSCTR                                                           281 - 295
//

Text Mined References (12)

PMID Year Title
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
22792334 2012 Identification of VHY/Dusp15 as a regulator of oligodendrocyte differentiation through a systematic genomics approach.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16170801 2005 Crystal structure of the catalytic domain of human VHY, a dual-specificity protein phosphatase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15138252 2004 VHY, a novel myristoylated testis-restricted dual specificity protein phosphatase related to VHX.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...