Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
tuberculosis 2010 1.0e-07
ovarian cancer 8519 7.5e-07
osteosarcoma 7950 3.9e-03
oligodendroglioma 2850 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5


  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.300 1.1e-02
osteosarcoma -1.133 3.9e-03
ovarian cancer -1.100 7.5e-07
tuberculosis 1.400 1.0e-07


Accession Q9H1Q7 Q5JUA5 Q5JUA6 Q6PK19 Q86WF5 Q96CG7 Q9H1Q6 Q9H6D1
Symbols FAM113A


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGGPCRQRLRHSERLIHTYKLDRRPPAHSGTWPG                                        421 - 454

Text Mined References (11)

PMID Year Title