Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 1.04125215323286E-7
ovarian cancer 8492 7.54128932305883E-7
osteosarcoma 7933 0.00387529095193228
oligodendroglioma 2849 0.0108735359790966

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.300 0.011
osteosarcoma -1.133 0.004
tuberculosis 1.400 0.000
ovarian cancer -1.100 0.000

Synonym

Accession Q9H1Q7 Q5JUA5 Q5JUA6 Q6PK19 Q86WF5 Q96CG7 Q9H1Q6 Q9H6D1
Symbols FAM113A
C20orf81
bA12M19.1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG

AA Sequence

MVFCLSSEEPRRPLRSDMVHFQASEVQQLLHNKFVVILGDSIQRAVYKDLVLLLQKDSLLTAAQLKAKGE      1 - 70
LSFEQDQLVAGGQLGELHNGTQYREVRQFCSGSGHHLVRFYFLTRVYSEYLEDVLEELTYGPAPDLVIIN     71 - 140
SCLWDLSRYGRCSMESYRENLERVFVRMDQVLPDSCLLVWNMAMPLGERITGGFLLPELQPLAGSLRRDV    141 - 210
VEGNFYSATLAGDHCFDVLDLHFHFRHAVQHRHRDGVHWDQHAHRHLSHLLLTHVADAWGVELPKRGYPP    211 - 280
DPWIEDWAEMNHPFQGSHRQTPDFGEHLALLPPPPSSLPPPMPFPYPLPQPSPPPLFPPLPQDTPFFPGQ    281 - 350
PFPPHEFFNYNPVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQHWGPVVHRGMPRYVPNSPYHVRR    351 - 420
MGGPCRQRLRHSERLIHTYKLDRRPPAHSGTWPG                                        421 - 454
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20056006 2010 Novel eukaryotic enzymes modifying cell-surface biopolymers.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15522763 2004 GDSL family of serine esterases/lipases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12601173 2003 Immunomic analysis of human sarcoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...