Property Summary

NCBI Gene PubMed Count 7
PubMed Score 42.57
PubTator Score 9.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 1.8e-07
lung carcinoma 2843 2.6e-05
non-small cell lung cancer 2890 5.0e-04
lung adenocarcinoma 2716 2.0e-03
Endometriosis 540 5.0e-02
Disease Target Count Z-score Confidence
Asthma 385 0.0 1.1
Disease Target Count Z-score Confidence
lung cancer 4740 4.63 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
Endometriosis -1.553 5.0e-02
lung adenocarcinoma -1.300 2.0e-03
lung carcinoma -2.200 2.6e-05
nasopharyngeal carcinoma -4.100 1.8e-07
non-small cell lung cancer -1.498 5.0e-04

Gene RIF (2)

AA Sequence

MAQKPLSTAAAERMNLVGQDEIWKYRLKAESEARQNWPQNWGFLTTPFEELIKCEEDLPTPKPKIELPER      1 - 70
FRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGVH        71 - 137
//

Text Mined References (7)

PMID Year Title