Property Summary

NCBI Gene PubMed Count 7
Grant Count 9
R01 Count 5
Funding $501,027.55
PubMed Score 38.50
PubTator Score 9.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25786037 our findings suggest that LLC1 is not a tumor suppressor, and that it is localized in the cilia of the normal lung epithelium but is absent in most non-small cell lung cancer cases
17304513 inactivation of LLC1 by means of promoter methylation is a frequent event in nonsmall cell lung cancer and may play a role in lung tumorigenesis.

AA Sequence

MAQKPLSTAAAERMNLVGQDEIWKYRLKAESEARQNWPQNWGFLTTPFEELIKCEEDLPTPKPKIELPER      1 - 70
FRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGVH        71 - 137
//

Text Mined References (7)

PMID Year Title
25786037 2015 Immunohistochemical localization of LLC1 in human tissues and its limited expression in non-small cell lung cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
17304513 2007 Inactivation of LLC1 gene in nonsmall cell lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.