Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.53
PubTator Score 5.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 0.003
hepatocellular carcinoma 1.300 0.000
pancreatic cancer 1.200 0.006
juvenile dermatomyositis 1.371 0.000
tuberculosis and treatment for 6 months -2.100 0.002
primary Sjogren syndrome 1.100 0.019
pancreatic carcinoma 1.200 0.006
Pick disease -1.500 0.000
progressive supranuclear palsy -1.400 0.010
ovarian cancer 2.400 0.000

Synonym

Accession Q9H1N7 A6NKX9 Q1XH11 Q6MZJ0 Q7Z662 Q9Y308
Symbols CGI-19
PAPST2
C6orf196

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
21211351 The specifically up-regulated non-coding gene HULC in HepG2 cell line has some effects on the expression of its neighboring gene SLC35B3.
20978009 PAPS transporters play a role in the proliferation of colorectal carcinoma cells themselves and take part in a desmoplastic reaction to support cancer growth by controlling their sulfation status.
16492677 PAPST2 is a PAPS transporter gene involved in the synthesis of sulfated glycoconjugates in the colon

AA Sequence

MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGM      1 - 70
NLSKFNKLTQFFICVAGVFVFYLIYGYLQELIFSVEGFKSCGWYLTLVQFAFYSIFGLIELQLIQDKRRR     71 - 140
IPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQGKRYNVADVSAAICMSLGL    141 - 210
IWFTLADSTTAPNFNLTGVVLISLALCADAVIGNVQEKAMKLHNASNSEMVLYSYSIGFVYILLGLTCTS    211 - 280
GLGPAVTFCAKNPVRTYGYAFLFSLTGYFGISFVLALIKIFGALIAVTVTTGRKAMTIVLSFIFFAKPFT    281 - 350
FQYVWSGLLVVLGIFLNVYSKNMDKIRLPSLYDLINKSVEARKSRTLAQTV                       351 - 401
//

Text Mined References (12)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21211351 2010 [Specifically up-regulated non-coding RNA gene HULC in tumor cell lines and its effects on the expression of neighboring gene SLC35B3].
20978009 2011 Expression and the role of 3'-phosphoadenosine 5'-phosphosulfate transporters in human colorectal carcinoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16793546 2006 Comparative analysis identifies exonic splicing regulatory sequences--The complex definition of enhancers and silencers.
16492677 2006 Molecular cloning and characterization of a novel 3'-phosphoadenosine 5'-phosphosulfate transporter, PAPST2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...