Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.53
PubTator Score 5.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 3.2e-03
hepatocellular carcinoma 1.300 8.9e-06
juvenile dermatomyositis 1.371 1.1e-13
ovarian cancer -1.300 5.4e-03
pancreatic cancer 1.200 5.8e-03
pancreatic carcinoma 1.200 5.8e-03
Pick disease -1.500 4.7e-05
primary Sjogren syndrome 1.100 1.9e-02
progressive supranuclear palsy -1.400 9.8e-03
tuberculosis and treatment for 3 months -1.400 4.3e-02

Gene RIF (3)

AA Sequence

MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGM      1 - 70
NLSKFNKLTQFFICVAGVFVFYLIYGYLQELIFSVEGFKSCGWYLTLVQFAFYSIFGLIELQLIQDKRRR     71 - 140
IPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQGKRYNVADVSAAICMSLGL    141 - 210
IWFTLADSTTAPNFNLTGVVLISLALCADAVIGNVQEKAMKLHNASNSEMVLYSYSIGFVYILLGLTCTS    211 - 280
GLGPAVTFCAKNPVRTYGYAFLFSLTGYFGISFVLALIKIFGALIAVTVTTGRKAMTIVLSFIFFAKPFT    281 - 350
FQYVWSGLLVVLGIFLNVYSKNMDKIRLPSLYDLINKSVEARKSRTLAQTV                       351 - 401
//

Text Mined References (12)

PMID Year Title