Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.72
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 8.1e-10

Gene RIF (5)

AA Sequence

MGLFMIIAILLFQKPTVTEQLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEACKKITKPP      1 - 70
RPKPATLALTLQDYVTIIENFPSLKTQST                                              71 - 99
//

Text Mined References (16)

PMID Year Title