Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.03
PubTator Score 1.32

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MKLLFPIFASLMLQYQVNTEFIGLRRCLMGLGRCRDHCNVDEKEIQKCKMKKCCVGPKVVKLIKNYLQYG      1 - 70
TPNVLNEDVQEMLKPAKNSSAVIQRKHILSVLPQIKSTSFFANTNFVIIPNATPMNSATISTMTPGQITY     71 - 140
TATSTKSNTKESRDSATASPPPAPPPPNILPTPSLELEEAEEQ                               141 - 183
//

Text Mined References (9)

PMID Year Title