Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.53
PubTator Score 1.32

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
12620395 The protein encoded by this gene is thought to display antimicrobial activity.

AA Sequence

MKLLFPIFASLMLQYQVNTEFIGLRRCLMGLGRCRDHCNVDEKEIQKCKMKKCCVGPKVVKLIKNYLQYG      1 - 70
TPNVLNEDVQEMLKPAKNSSAVIQRKHILSVLPQIKSTSFFANTNFVIIPNATPMNSATISTMTPGQITY     71 - 140
TATSTKSNTKESRDSATASPPPAPPPPNILPTPSLELEEAEEQ                               141 - 183
//

Text Mined References (9)

PMID Year Title
25310821 2014 A genome-wide association study identifies potential susceptibility loci for Hirschsprung disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12620395 2003 Distribution of new human beta-defensin genes clustered on chromosome 20 in functionally different segments of epididymis.
12600824 2003 ORFeome-based search of airway epithelial cell-specific novel human [beta]-defensin genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.