Property Summary

NCBI Gene PubMed Count 11
Grant Count 20
R01 Count 18
Funding $1,301,108.34
PubMed Score 179.11
PubTator Score 83.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (3)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
22395867 The genes CECR2, SLC25A18 and ATP6V1E1, mapping within the critical region for cat eye syndrome (CES), may be responsible for anorectal, renal and preauricular anomalies in patients with CES.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTHQDLSITAKLINGGVAGLVGVTCVFPIDLAKTRLQNQHGKAMYKGMIDCLMKTARAEGFFGMYRGAAV      1 - 70
NLTLVTPEKAIKLAANDFFRRLLMEDGMQRNLKMEMLAGCGAGMCQVVVTCPMEMLKIQLQDAGRLAVHH     71 - 140
QGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLAGLYRGLGATLLRDIPFSIIYFPLFANLNNL    141 - 210
GFNELAGKASFAHSFVSGCVAGSIAAVAVTPLDVLKTRIQTLKKGLGEDMYSGITDCARKLWIQEGPSAF    211 - 280
MKGAGCRALVIAPLFGIAQGVYFIGIGERILKCFD                                       281 - 315
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22395867 2012 A 600?kb triplication in the cat eye syndrome critical region causes anorectal, renal and preauricular anomalies in a three-generation family.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11897791 2002 Identification of the mitochondrial glutamate transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution of two human isoforms.
More...