Property Summary

NCBI Gene PubMed Count 11
PubMed Score 191.93
PubTator Score 83.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.800 7.0e-04
Astrocytoma, Pilocytic -1.900 4.1e-05
atypical teratoid / rhabdoid tumor -2.500 2.2e-04
ependymoma -1.800 3.2e-05
glioblastoma -2.000 4.0e-06
group 3 medulloblastoma -4.200 2.2e-06
medulloblastoma, large-cell -4.100 1.2e-05
osteosarcoma -1.016 1.2e-03
pancreatic ductal adenocarcinoma liver m... -2.265 3.8e-02
primitive neuroectodermal tumor -2.600 3.2e-03
psoriasis -2.300 4.5e-33

Gene RIF (3)

AA Sequence

MTHQDLSITAKLINGGVAGLVGVTCVFPIDLAKTRLQNQHGKAMYKGMIDCLMKTARAEGFFGMYRGAAV      1 - 70
NLTLVTPEKAIKLAANDFFRRLLMEDGMQRNLKMEMLAGCGAGMCQVVVTCPMEMLKIQLQDAGRLAVHH     71 - 140
QGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLAGLYRGLGATLLRDIPFSIIYFPLFANLNNL    141 - 210
GFNELAGKASFAHSFVSGCVAGSIAAVAVTPLDVLKTRIQTLKKGLGEDMYSGITDCARKLWIQEGPSAF    211 - 280
MKGAGCRALVIAPLFGIAQGVYFIGIGERILKCFD                                       281 - 315
//

Text Mined References (12)

PMID Year Title