Property Summary

NCBI Gene PubMed Count 43
Grant Count 47
R01 Count 25
Funding $3,120,897.41
PubMed Score 157.76
PubTator Score 62.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.100 0.038
medulloblastoma, large-cell -1.700 0.000
ovarian cancer -2.000 0.000

Gene RIF (27)

PMID Text
26560363 ISCU expression was decreased in the majority of human liver cancer tissues, and its reduced expression was significantly associated with p53 mutation.
26016389 The core Fe-S biosynthetic enzymatic complex generated [2Fe-2S] cluster intermediates that converted to stable [2Fe-2S] clusters bound to uncomplexed ISCU2.
25825391 Thus, driven by acquired (hypoxia) or genetic causes, the miR-210-ISCU1/2 regulatory axis is a pathogenic lynchpin causing iron-sulfur deficiency and pulmonary hypertension.
25204651 IscU is a new substrate of MK2 both in Drosophila cells and in human cells
24971490 Fe-S assembly protein (ISCU2) and frataxin convert substrates l-cysteine, ferrous iron, and electrons into Fe-S clusters.
24573684 the G50E iron-sulfur cluster scaffold protein (ISCU) mutation has a role in mitochondrial myopathy
23940031 NFS1 binds preferentially to the D-state of ISCU while mtHSP70 binds preferentially to the D-state of ISCU and HSC20 binds preferentially to the S-state of ISCU.
23508953 mTORC1 associates with ISCU and phosphorylates ISCU at serine 14. This phosphorylation stabilized ISCU protein.
23449350 MicroRNA-210 correlates negatively with its gene target ISCU at the protein and mRNA level. MicroRNA-210 correlated with positive outcome variables
23035118 ISCU protein deficiency in patients results from muscle-specific mis-splicing and oxidative stress.
More...

AA Sequence

MAAAGAFRLRRAASALLLRSPRLPARELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACG      1 - 70
DVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSM     71 - 140
LAEDAIKAALADYKLKQEPKKGEAEKK                                               141 - 167
//

Text Mined References (50)

PMID Year Title
26560363 2015 Regulation of iron homeostasis by the p53-ISCU pathway.
26100117 2016 Functional Analysis of GLRX5 Mutants Reveals Distinct Functionalities of GLRX5 Protein.
26016389 2015 The Human Iron-Sulfur Assembly Complex Catalyzes the Synthesis of [2Fe-2S] Clusters on ISCU2 That Can Be Transferred to Acceptor Molecules.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25825391 2015 Genetic and hypoxic alterations of the microRNA-210-ISCU1/2 axis promote iron-sulfur deficiency and pulmonary hypertension.
25416956 2014 A proteome-scale map of the human interactome network.
25245479 2015 Iron-sulfur cluster biogenesis in mammalian cells: New insights into the molecular mechanisms of cluster delivery.
25204651 2014 The p38 pathway regulates oxidative stress tolerance by phosphorylation of mitochondrial protein IscU.
24971490 2014 Human frataxin activates Fe-S cluster biosynthesis by facilitating sulfur transfer chemistry.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
More...