Property Summary

NCBI Gene PubMed Count 49
PubMed Score 167.29
PubTator Score 62.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.100 3.8e-02
medulloblastoma, large-cell -1.700 9.8e-06
ovarian cancer -2.000 1.4e-07

Gene RIF (30)

AA Sequence

MAAAGAFRLRRAASALLLRSPRLPARELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACG      1 - 70
DVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSM     71 - 140
LAEDAIKAALADYKLKQEPKKGEAEKK                                               141 - 167
//

Text Mined References (56)

PMID Year Title