Property Summary

NCBI Gene PubMed Count 18
PubMed Score 148.41
PubTator Score 12.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.7e-04
glioblastoma -1.100 3.1e-03
juvenile dermatomyositis 1.083 1.8e-13
medulloblastoma, large-cell -1.700 1.2e-05
osteosarcoma -1.059 7.2e-03
ovarian cancer -1.800 2.2e-10
subependymal giant cell astrocytoma -1.530 6.2e-03

Protein-protein Interaction (8)

Gene RIF (4)

AA Sequence

MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKDRLLKREGDDR      1 - 70
AESGTQGYESFSYGGVDPYMWEPQELGAVRSHLSDFKKHRAARIDHYVVEVNKLIIRLEKLTAFDRTNTE     71 - 140
SAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCRLCGSIMCKKCMELISLPLANKLTSASKESL    141 - 210
STHTSPSQSPNSVHGSRRGSISSMSSVSSVLDEKDDDRIRCCTHCKDTLLKREQQIDEKEHTPDIVKLYE    211 - 280
KLRLCMEKVDQKAPEYIRMAASLNAGETTYSLEHASDLRVEVQKVYELIDALSKKILTLGLNQDPPPHPS    281 - 350
NLRLQRMIRYSATLFVQEKLLGLMSLPTKEQFEELKKKRKEEMERKRAVERQAALESQRRLEERQSGLAS    351 - 420
RAANGEVASLRRGPAPLRKAEGWLPLSGGQGQSEDSDPLLQQIHNITSFIRQAKAAGRMDEVRTLQENLR    421 - 490
QLQDEYDQQQTEKAIELSRRQAEEEDLQREQLQMLRERELEREREQFRVASLHTRTRSLDFREIGPFQLE    491 - 560
PSREPRTHLAYALDLGSSPVPSSTAPKTPSLSSTQPTRVWSGPPAVGQERLPQSSMPQQHEGPSLNPFDE    561 - 630
EDLSSPMEEATTGPPAAGVSLDPSARILKEYNPFEEEDEEEEAVAGNPFIQPDSPAPNPFSEEDEHPQQR    631 - 700
LSSPLVPGNPFEEPTCINPFEMDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQCGRLDEVEVLTENLR    701 - 770
ELKHTLAKQKGGTD                                                            771 - 784
//

Text Mined References (24)

PMID Year Title