Property Summary

NCBI Gene PubMed Count 37
PubMed Score 40.16
PubTator Score 26.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 1.8e-02
Breast cancer -1.200 1.5e-06
group 3 medulloblastoma 1.300 1.4e-02
non-small cell lung cancer 1.011 1.1e-05
psoriasis 1.100 2.4e-02

 GWAS Trait (1)

 CSPA Cell Line (1)

Gene RIF (26)

AA Sequence

MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMA      1 - 70
YIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAVSAAGVVNAISRACREGELST     71 - 140
CGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVY    141 - 210
KMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVY    211 - 280
VDPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT    281 - 350
EIVDQYICK                                                                 351 - 359
//

Text Mined References (38)

PMID Year Title