Property Summary

NCBI Gene PubMed Count 30
Grant Count 16
Funding $1,028,646.35
PubMed Score 37.29
PubTator Score 26.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.100 0.024
atypical teratoid / rhabdoid tumor 1.400 0.018
non-small cell lung cancer 1.011 0.000
group 3 medulloblastoma 1.300 0.014
Breast cancer -1.200 0.000

Gene RIF (19)

PMID Text
25425204 The interaction between Wnt isoforms and their LRP6 cognate receptor depends on the jutting loop present in Wnt3a but absent in Wnt5b.
25246426 Results demonstrate that the Wnt5B pathway may play an important role in atypical teratoid rhabdoid tumor biology.
24944491 Report increased Wnt5b levels in adriamycin treated liver cancer stem cells within 4h of treatment.
24841200 Knocking down Wnt5b expression reduced phospho-PKCA levels and cell migration.
24564888 WNT5B is elevated in both in the tumor and the patients' serum from triple negative breast cancer.
24399733 Ursolic acid suppressed the expression of Wnt5alpha/beta and beta-catenin, inducing apoptosis in prostate cancer cells.
24344732 WNT3 and WNT5B are critical factors, secreted from mesenchymal cancer cells, for instigating the epithelial cancer cell invasion.
24220306 These results indicate that Wnt5b is involved in the migration ability of OSCC cells through active Cdc42 and RhoA.
24040439 TGF-beta/Smad, integrin/integrin-linked kinase (ILK) and wnt/beta-catenin signaling pathways are involved in epithelial to mesenchymal transition in human renal fibrogenesis.
23817222 This study shows that the WNT5B germline variant rs2010851 was significantly identified as a stage-dependent prognostic marker for CC patients after 5-fluorouracil-based adjuvant therapy.
More...

AA Sequence

MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMA      1 - 70
YIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAVSAAGVVNAISRACREGELST     71 - 140
CGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVY    141 - 210
KMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVY    211 - 280
VDPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT    281 - 350
EIVDQYICK                                                                 351 - 359
//

Text Mined References (31)

PMID Year Title
25425204 2015 Sequence and structural difference favors a distinct preference of Wnt3a binding with co-receptor LRP6.
25246426 2015 Wnt pathway in atypical teratoid rhabdoid tumors.
24944491 2014 Influence of adriamycin on changes in Nanog, Oct-4, Sox2, ARID1 and Wnt5b expression in liver cancer stem cells.
24841200 2014 MicroRNA-200b suppresses arsenic-transformed cell migration by targeting protein kinase C? and Wnt5b-protein kinase C? positive feedback loop and inhibiting Rac1 activation.
24564888 2014 Wnt modulates MCL1 to control cell survival in triple negative breast cancer.
24399733 2013 Inhibition of Wnt/?-catenin signaling mediates ursolic acid-induced apoptosis in PC-3 prostate cancer cells.
24344732 2014 Mesenchymal-transitioned cancer cells instigate the invasion of epithelial cancer cells through secretion of WNT3 and WNT5B.
24220306 2014 Wnt5b promotes the cell motility essential for metastasis of oral squamous cell carcinoma through active Cdc42 and RhoA.
24040439 2013 The differential expression of TGF-?1, ILK and wnt signaling inducing epithelial to mesenchymal transition in human renal fibrogenesis: an immunohistochemical study.
23817222 2014 Association of common gene variants in the WNT/?-catenin pathway with colon cancer recurrence.
More...