Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
R01 Count 4
Funding $312,362.8
PubMed Score 17.37
PubTator Score 10.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q9H1J5 Q96S51
Symbols WNT8D

Gene

PANTHER Protein Class (1)

 GWAS Trait (1)

Gene RIF (4)

PMID Text
23836442 the WNT8A gene is involved in the susceptibility to HSCR, and plays an important role in the occurrence and development of Hirschsprung's disease.
20890934 Observational study of gene-disease association. (HuGE Navigator)
18413325 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11956596 Expression and regulation of WNT8A mRNA in human tumor cell lines

AA Sequence

MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENAL      1 - 70
QLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCSDNVEFGE     71 - 140
RISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKA    141 - 210
KYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSH    211 - 280
NTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQCRHVVSKYYCARSPGSAQSLGKGS    281 - 350
A//

Text Mined References (9)

PMID Year Title
23836442 2013 Polymorphisms and expression of the WNT8A gene in Hirschsprung's disease.
22544366 2012 Meta-analysis identifies six new susceptibility loci for atrial fibrillation.
20890934 2010 Studies with Wnt genes and nonsyndromic cleft lip and palate.
20559569 2010 Endogenous Wnt/beta-catenin signaling is required for cardiac differentiation in human embryonic stem cells.
18413325 2008 Variation in WNT genes is associated with non-syndromic cleft lip with or without cleft palate.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956596 2002 Expression and regulation of WNT8A and WNT8B mRNAs in human tumor cell lines: up-regulation of WNT8B mRNA by beta-estradiol in MCF-7 cells, and down-regulation of WNT8A and WNT8B mRNAs by retinoic acid in NT2 cells.
11408932 2001 Molecular cloning and characterization of human WNT8A.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.