Property Summary

NCBI Gene PubMed Count 10
PubMed Score 21.10
PubTator Score 10.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Atrial Fibrillation 124 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 2.2

Expression

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENAL      1 - 70
QLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCSDNVEFGE     71 - 140
RISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKA    141 - 210
KYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSH    211 - 280
NTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQCRHVVSKYYCARSPGSAQSLGKGS    281 - 350
A//

Text Mined References (10)

PMID Year Title