Property Summary

NCBI Gene PubMed Count 24
Grant Count 5
R01 Count 5
Funding $171,388.67
PubMed Score 11.05
PubTator Score 12.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
24859087 kjh kiiou ouiy 8yt 8iy 7i9y
24462287 KIF13A interacts and cooperates with RAB11 to generate endosomal tubules.
21873978 the kinesin-13 MCAK has an unconventional ATPase cycle adapted for microtubule depolymerization
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20208530 PtdIns(3)P production is essential for proper cytokinesis. PtdIns(3)P-binding centrosomal protein FYVE-CENT and TTC19 control cytokinesis through their translocation from the centrosome to the midbody mediated by the kinesin protein KIF13A.
19841138 show that the clathrin adaptor AP-1 and the kinesin motor KIF13A together create peripheral recycling endosomal subdomains in melanocytes required for cargo delivery to maturing melanosomes.
19328558 Observational study of gene-disease association. (HuGE Navigator)
11106728 Functionally characterizes the homologous mouse protein.

AA Sequence

MSDTKVKVAVRVRPMNRRELELNTKCVVEMEGNQTVLHPPPSNTKQGERKPPKVFAFDYCFWSMDESNTT      1 - 70
KYAGQEVVFKCLGEGILEKAFQGYNACIFAYGQTGSGKSFSMMGHAEQLGLIPRLCCALFKRISLEQNES     71 - 140
QTFKVEVSYMEIYNEKVRDLLDPKGSRQSLKVREHKVLGPYVDGLSQLAVTSFEDIESLMSEGNKSRTVA    141 - 210
ATNMNEESSRSHAVFNIIITQTLYDLQSGNSGEKVSKVSLVDLAGSERVSKTGAAGERLKEGSNINKSLT    211 - 280
TLGLVISSLADQAAGKGKSKFVPYRDSVLTWLLKDNLGGNSQTSMIATISPAADNYEETLSTLRYADRAK    281 - 350
RIVNHAVVNEDPNAKVIRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELTVTWEEKLRKTEEI    351 - 420
AQERQRQLESMGISLEMSGIKVGDDKCYLVNLNADPALNELLVYYLKDHTRVGADTSQDIQLFGIGIQPQ    421 - 490
HCEIDIASDGDVTLTPKENARSCVNGTLVCSTTQLWHGDRILWGNNHFFRINLPKRKRRDWLKDFEKETG    491 - 560
PPEHDLDAASEASSEPDYNYEFAQMEVIMKTLNSNDPVQNVVQVLEKQYLEEKRSALEEQRLMYERELEQ    561 - 630
LRQQLSPDRQPQSSGPDRLAYSSQTAQQKVTQWAEERDELFRQSLAKLREQLVKANTLVREANFLAEEMS    631 - 700
KLTDYQVTLQIPAANLSANRKRGAIVSEPAIQVRRKGKSTQVWTIEKLENKLIDMRDLYQEWKEKVPEAK    701 - 770
RLYGKRGDPFYEAQENHNLIGVANVFLECLFCDVKLQYAVPIISQQGEVAGRLHVEVMRVTGAVPERVVE    771 - 840
DDSSENSSESGSLEVVDSSGEIIHRVKKLTCRVKIKEATGLPLNLSNFVFCQYTFWDQCESTVAAPVVDP    841 - 910
EVPSPQSKDAQYTVTFSHCKDYVVNVTEEFLEFISDGALAIEVWGHRCAGNGSSIWEVDSLHAKTRTLHD    911 - 980
RWNEVTRRIEMWISILELNELGEYAAVELHQAKDVNTGGIFQLRQGHSRRVQVTVKPVQHSGTLPLMVEA    981 - 1050
ILSVSIGCVTARSTKLQRGLDSYQRDDEDGDDMDSYQEEDLNCVRERWSDALIKRREYLDEQIKKVSNKT   1051 - 1120
EKTEDDVEREAQLVEQWVGLTEERNAVLVPAPGSGIPGAPADWIPPPGMETHIPVLFLDLNADDLSANEQ   1121 - 1190
LVGPHASGVNSILPKEHGSQFFYLPIIKHSDDEVSATASWDSSVHDSVHLNRVTPQNERIYLIVKTTVQL   1191 - 1260
SHPAAMELVLRKRIAANIYNKQSFTQSLKRRISLKNIFYSCGVTYEIVSNIPKATEEIEDRETLALLAAR   1261 - 1330
SENEGTSDGETYIEKYTRGVLQVENILSLERLRQAVTVKEALSTKARHIRRSLSTPNVHNVSSSRPDLSG   1331 - 1400
FDEDDKGWPENQLDMSDYSSSYQDVACYGTLPRDSPRRNKEGCTSETPHALTVSPFKAFSPQPPKFFKPL   1401 - 1470
MPVKEEHKKRIALEARPLLSQESMPPPQAHNPGCIVPSGSNGSSMPVEHNSKREKKIDSEEEENELEAIN   1471 - 1540
RKLISSQPYVPVEFADFSVYNASLENREWFSSKVDLSNSRVLEKEVSRSPTTSSITSGYFSHSASNATLS   1541 - 1610
DMVVPSSDSSDQLAIQTKDADSTEHSTPSLVHDFRPSSNKELTEVEKGLVKDKIIVVPLKENSALAKGSP   1611 - 1680
SSQSIPEKNSKSLCRTGSCSELDACPSKISQPARGFCPREVTVEHTTNILEDHSFTEFMGVSEGKDFDGL   1681 - 1750
TDSSAGELSSRRSLPNKTGGKTVSDGLHHPSQLHSKLENDQVIIPEAAFWVLCCQ                  1751 - 1805
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24859087 2014 DHTP is an allosteric inhibitor of the kinesin-13 family of microtubule depolymerases.
24462287 2014 Recycling endosome tubule morphogenesis from sorting endosomes requires the kinesin motor KIF13A.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21873978 2011 The kinesin-13 MCAK has an unconventional ATPase cycle adapted for microtubule depolymerization.
21269460 2011 Initial characterization of the human central proteome.
20798811 2010 Gadkin: A novel link between endosomal vesicles and microtubule tracks.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...