Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.81
PubTator Score 3.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.116 2.6e-04
atypical teratoid / rhabdoid tumor -1.200 3.0e-04
Breast cancer -1.500 1.2e-09
breast carcinoma -1.100 1.0e-24
lung adenocarcinoma -1.200 2.3e-08
lung cancer 1.100 4.3e-03
lung carcinoma 1.200 1.7e-25
malignant mesothelioma -1.900 3.9e-07
medulloblastoma, large-cell -1.300 1.1e-03
Multiple myeloma 1.580 1.5e-02
non-small cell lung cancer -1.084 1.7e-13
ovarian cancer -1.700 1.3e-09
pancreatic ductal adenocarcinoma liver m... -1.363 2.4e-03
psoriasis -1.100 7.0e-07
Waldenstrons macroglobulinemia 1.307 3.4e-02

Gene RIF (3)

AA Sequence

MAGGRCGPQLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQT      1 - 70
DSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKW     71 - 140
QSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFMGLVLVVI    141 - 210
SECFYVPLPRHLSERSEQNRRSEEAHRAEQLQDAEEEKDDSNEEENKDSLVDDEEEKEDLGDEDEAEEEE    211 - 280
EEDNLAAGVDEERSEANDQGPPGEDGVTREEVEPEEAEEGISEQPCPADTEVVEDSLRQRKSQHADKGL     281 - 349
//

Text Mined References (17)

PMID Year Title