Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.81
PubTator Score 3.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.307 0.034
Multiple myeloma 1.580 0.015
malignant mesothelioma -1.900 0.000
psoriasis -1.100 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.300 0.001
acute quadriplegic myopathy 1.260 0.000
pancreatic ductal adenocarcinoma liver m... -1.363 0.002
non-small cell lung cancer -1.084 0.000
lung cancer 1.100 0.004
lung adenocarcinoma -1.200 0.000
Breast cancer -1.500 0.000
lung carcinoma 1.200 0.000
breast carcinoma -1.100 0.000
ovarian cancer -3.800 0.000

Synonym

Accession Q9H1E5 Q8N4P7 Q8NCC1 Q9UJA1 Q9ULQ8
Symbols PDIA14
TXNDC13
DJ971N18.2

Gene

Gene RIF (2)

PMID Text
20056998 Data identify a novel transmembrane Trx-like protein 4 (TMX4), in the ER of mammalian cells, and confirm that the Trx-like domain has reductase activity in vitro.
19811453 Data show that features not commonly found in other PDIs characterize TMX4 and suggest unique functional properties of the protein.

AA Sequence

MAGGRCGPQLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQT      1 - 70
DSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKW     71 - 140
QSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFMGLVLVVI    141 - 210
SECFYVPLPRHLSERSEQNRRSEEAHRAEQLQDAEEEKDDSNEEENKDSLVDDEEEKEDLGDEDEAEEEE    211 - 280
EEDNLAAGVDEERSEANDQGPPGEDGVTREEVEPEEAEEGISEQPCPADTEVVEDSLRQRKSQHADKGL     281 - 349
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056998 2010 Novel thioredoxin-related transmembrane protein TMX4 has reductase activity.
19811453 2009 A di-arginine motif contributes to the ER localization of the type I transmembrane ER oxidoreductase TMX4.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...