Property Summary

NCBI Gene PubMed Count 43
Grant Count 13
R01 Count 13
Funding $1,165,286.09
PubMed Score 25.75
PubTator Score 27.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (22)

PMID Text
26968889 NUCKS1 was identified as a potential oncogene at chromosomal 1q32.1 in patients with HCC, and it might be a valuable immunodiagnostic marker for HCC
26323318 The results show that NUCKS1 is a chromatin-associated protein with a role in the DNA damage response and in homologous recombination, a DNA repair pathway critical for tumor suppression.
25119009 We would like to emphasize that NUCKS abundance in malignant skin tumors is higher than that of the well-known proliferation marker Ki67, thus allowing more precise assessment of tumor proliferation potential.
25116364 NUCKS1 expression did not increase Tat nuclear localization.
25116364 Overexpression of NUCKS1 moderately induces HIV-1 production with increased release of p24 without PMA stimulation in latently infected cells
25116364 Overexpression of NUCKS1 moderately induces HIV-1 production with increased release of p24 without PMA stimulation in latently infected cells
25116364 Overexpression of NUCKS1 moderately induces HIV-1 production with increased release of p24 without PMA stimulation in latently infected cells
24931609 NUCKS is a physiological regulator of energy homeostasis and glucose metabolism that works by regulating chromatin accessibility and RNA polymerase II recruitment to the promoters of IR and other insulin pathway modulators.
24819170 NUCKS1 overexpression may be associated with tumour progression and recurrence in cervical squamous cell carcinoma
24568505 NUCKS-1 overexpression is associated with obesity and with breast cancer.
More...

AA Sequence

MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKK      1 - 70
DDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMED     71 - 140
DDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDE    141 - 210
EPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED                                         211 - 243
//

Text Mined References (59)

PMID Year Title
26968889 2016 Identification of NUCKS1 as a putative oncogene and immunodiagnostic marker of hepatocellular carcinoma.
26323318 2015 NUCKS1 is a novel RAD51AP1 paralog important for homologous recombination and genome stability.
25434496 2015 Genetic variants at 1q32.1, 10q11.2 and 19q13.41 are associated with prostate-specific antigen for prostate cancer screening in two Korean population-based cohort studies.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25119009 2014 The comparison of nuclear ubiquitous casein and cyclin-dependent kinases substrate (NUCKS) with Ki67 proliferation marker expression in common skin tumors.
25116364 2014 NUCKS1, a novel Tat coactivator, plays a crucial role in HIV-1 replication by increasing Tat-mediated viral transcription on the HIV-1 LTR promoter.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24931609 2014 NUCKS is a positive transcriptional regulator of insulin signaling.
24842889 2014 Genome-wide mapping of IBD segments in an Ashkenazi PD cohort identifies associated haplotypes.
More...