Property Summary

NCBI Gene PubMed Count 45
PubMed Score 29.22
PubTator Score 27.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.500 2.3e-03
atypical teratoid / rhabdoid tumor -1.200 2.9e-04
Breast cancer 2.500 4.5e-02
group 4 medulloblastoma 1.300 2.3e-02
hereditary spastic paraplegia -1.067 1.8e-02
juvenile dermatomyositis 1.085 1.6e-05
medulloblastoma, large-cell -1.300 5.8e-04
Multiple myeloma 1.122 1.0e-02
nasopharyngeal carcinoma 1.100 6.5e-05
osteosarcoma 1.058 1.3e-02
ovarian cancer -1.300 5.0e-05
pancreatic cancer -1.300 1.2e-02
pancreatic carcinoma -1.300 1.2e-02
pancreatic ductal adenocarcinoma liver m... -1.735 4.8e-02
subependymal giant cell astrocytoma -2.138 3.5e-02
Waldenstrons macroglobulinemia 1.564 2.0e-03

Synonym

Accession Q9H1E3 Q54AC0 Q5PXE7 Q9H1D6 Q9H723
Symbols JC7
NUCKS

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (22)

AA Sequence

MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKK      1 - 70
DDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMED     71 - 140
DDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDE    141 - 210
EPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED                                         211 - 243
//

Text Mined References (61)

PMID Year Title