Property Summary

NCBI Gene PubMed Count 21
Grant Count 10
R01 Count 4
Funding $313,778.19
PubMed Score 31.41
PubTator Score 40.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
Atopic dermatitis -2.200 0.000
psoriasis 3.200 0.000
spina bifida -2.465 0.039

Gene RIF (13)

PMID Text
24747887 epidermal growth factor-dependent RNase 7 and human beta-defensin-3 expression upon infection with Trichophytum rubrum
24107847 RNH1 bound to RNase 7 and suppressed its antimicrobial activity by blocking its ability to bind the cell wall of uropathogenic bacteria.
23614747 Levels of psoriasin, RNase 7 and hBD-3 expression - assessed by immunohistochemistry - varied between different body localisations.
23555696 the influence of STAT3 on the IL-17A/IFN-gamma -mediated RNase 7 induction
23545750 Suggest that RNase 7 may function as antimicrobial peptide with a role in the differentiation and development of the primitive epidermis.
23469087 a complex relationship between tear induction of miR-762, its modulation of innate defense genes, and P. aeruginosa internalization
23302724 RNase 7 expression is increased in the urinary tract with infection and has antibacterial activity against uropathogens at micromolar concentrations.
20668470 RNASE7 prevents staphylococcal skin infections
19919305 These findings suggest that antimicrobial peptides found at high baseline levels in healthy skin, such as RNase 7, confer protection against Staphylococcus aureus infection of the skin.
19641608 data indicate that RNase 7 contributes to the E. faecium-killing activity of skin extracts and suggest an important role for RNase 7 in the protection of human skin against E. faecium colonization
More...

AA Sequence

MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNT      1 - 70
FLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKK     71 - 140
DSQQFHLVPVHLDRVL                                                          141 - 156
//

Text Mined References (23)

PMID Year Title
24747887 2014 Infection of keratinocytes with Trichophytum rubrum induces epidermal growth factor-dependent RNase 7 and human beta-defensin-3 expression.
24107847 2014 An endogenous ribonuclease inhibitor regulates the antimicrobial activity of ribonuclease 7 in the human urinary tract.
23614747 2013 Differential expression and in vivo secretion of the antimicrobial peptides psoriasin (S100A7), RNase 7, human beta-defensin-2 and -3 in healthy human skin.
23555696 2013 IL-17A and IFN-? synergistically induce RNase 7 expression via STAT3 in primary keratinocytes.
23545750 2013 Prenatal human skin expresses the antimicrobial peptide RNase 7.
23469087 2013 MicroRNA-762 is upregulated in human corneal epithelial cells in response to tear fluid and Pseudomonas aeruginosa antigens and negatively regulates the expression of host defense genes encoding RNase7 and ST2.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23302724 2013 Ribonuclease 7, an antimicrobial peptide upregulated during infection, contributes to microbial defense of the human urinary tract.
20668470 2010 RNase 7 protects healthy skin from Staphylococcus aureus colonization.
20180804 2010 Comparison of human RNase 3 and RNase 7 bactericidal action at the Gram-negative and Gram-positive bacterial cell wall.
More...