Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.76
PubTator Score 6.78

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
Breast cancer 3577 2.2e-02


  Differential Expression (1)

Disease log2 FC p
Breast cancer 4.600 2.2e-02

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

GLVRAPCGLCPVFDDCHEGGEISPSNCIYMTEWLEF                                      281 - 316

Text Mined References (25)

PMID Year Title