Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.25
PubTator Score 6.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Breast cancer 3,094

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 4.600 0.022

Synonym

Accession Q9H1D9 A8K4C7 O15319 RNA polymerase III subunit C6
Symbols RPC6
RPC39

Gene

PDB

2DK5   2YU3  

Gene RIF (3)

PMID Text
18187620 HIV-1 Tat upregulates the transcription by RNA polymerase III of co-transfected or endogenous cellular Alu-repeated sequences by activating transcription factor TFIIIC
18187620 Knockdown of polymerase (RNA) III (DNA directed) polypeptide F (POLR3F) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
1403646 HIV-1 Tat upregulates the transcription by RNA polymerase III of co-transfected or endogenous cellular Alu-repeated sequences by activating transcription factor TFIIIC

AA Sequence

MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNT      1 - 70
GLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVK     71 - 140
SVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQRNSSF    141 - 210
ASSHEVWKYICELGISKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPT    211 - 280
GLVRAPCGLCPVFDDCHEGGEISPSNCIYMTEWLEF                                      281 - 316
//

Text Mined References (22)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24107381 2014 Gene duplication and neofunctionalization: POLR3G and POLR3GL.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20888865 2011 PNRC accumulates in the nucleolus by interaction with B23/nucleophosmin via its nucleolar localization sequence.
19631370 2009 RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.
19609254 2009 RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.
17612402 2007 PNRC is a unique nuclear receptor coactivator that stimulates RNA polymerase III-dependent transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...