Tchem | Transient receptor potential cation channel subfamily V member 6 |
Calcium selective cation channel that mediates Ca(2+) uptake in various tissues, including the intestine (PubMed:11097838, PubMed:11278579, PubMed:11248124 PubMed:15184369, PubMed:23612980). Important for normal Ca(2+) ion homeostasis in the body, including bone and skin (By similarity). The channel is activated by low internal calcium level, probably including intracellular calcium store depletion, and the current exhibits an inward rectification (PubMed:15184369). Inactivation includes both a rapid Ca(2+)-dependent and a slower Ca(2+)-calmodulin-dependent mechanism; the latter may be regulated by phosphorylation. In vitro, is slowly inhibited by Mg(2+) in a voltage-independent manner. Heteromeric assembly with TRPV5 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating.
This gene encodes a member of a family of multipass membrane proteins that functions as calcium channels. The encoded protein contains N-terminal ankyrin repeats, which are required for channel assembly and regulation. Translation initiation for this protein occurs at a non-AUG start codon that is decoded as methionine. This gene is situated next to a closely related gene for transient receptor potential cation channel subfamily V member 5 (TRPV5). This locus has experienced positive selection in non-African populations, resulting in several non-synonymous codon differences among individuals of different genetic backgrounds. [provided by RefSeq, Feb 2015]
This gene encodes a member of a family of multipass membrane proteins that functions as calcium channels. The encoded protein contains N-terminal ankyrin repeats, which are required for channel assembly and regulation. Translation initiation for this protein occurs at a non-AUG start codon that is decoded as methionine. This gene is situated next to a closely related gene for transient receptor potential cation channel subfamily V member 5 (TRPV5). This locus has experienced positive selection in non-African populations, resulting in several non-synonymous codon differences among individuals of different genetic backgrounds. [provided by RefSeq, Feb 2015]
Comments
Disease | Target Count |
---|---|
Polycystic Ovary Syndrome | 335 |
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 1.79814712672353E-63 |
atypical teratoid / rhabdoid tumor | 4369 | 3.77728576059573E-6 |
ovarian cancer | 8492 | 2.61992167928603E-5 |
medulloblastoma, large-cell | 6234 | 4.07184537864754E-5 |
glioblastoma | 5572 | 4.34351516870765E-5 |
adult high grade glioma | 2148 | 1.77079567740076E-4 |
cutaneous lupus erythematosus | 1056 | 0.00117166066202821 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 0.00346893311819466 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.0208650304646253 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Cri-Du-Chat syndrome | 16 | 7.305 | 3.7 |
Microcephaly | 149 | 4.078 | 2.0 |
Hypervitaminosis D | 8 | 3.667 | 1.8 |
Intellectual disability | 573 | 3.636 | 1.8 |
Corneal staphyloma | 4 | 3.632 | 1.8 |
Rickets | 42 | 3.434 | 1.7 |
Osteoporosis | 259 | 3.246 | 1.6 |
Schnyder Corneal Dystrophy | 24 | 3.223 | 1.6 |
Prostate cancer | 172 | 3.199 | 1.6 |
Disease | log2 FC | p |
---|---|---|
cutaneous lupus erythematosus | -1.500 | 0.001 |
psoriasis | -1.400 | 0.000 |
atypical teratoid / rhabdoid tumor | -1.400 | 0.000 |
glioblastoma | -1.500 | 0.000 |
medulloblastoma, large-cell | -1.600 | 0.000 |
intraductal papillary-mucinous adenoma (... | -1.400 | 0.003 |
intraductal papillary-mucinous neoplasm ... | -1.500 | 0.021 |
adult high grade glioma | -1.700 | 0.000 |
ovarian cancer | -1.200 | 0.000 |
Species | Source |
---|---|
Mouse | OMA Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA Inparanoid |
Cow | OMA Inparanoid |
Pig | OMA Inparanoid |
Opossum | OMA Inparanoid |
PMID | Text |
---|---|
26818094 | TRPV6 is down-regulated in esophageal squamous cell carcinoma and plays a role in predicting survival of male and female patients. |
26563429 | TRPV6 calcium ion channel plays a critical role in flow-induced Ca(2+) influx and microvilli formation. |
26449889 | our results demonstrate that hCAT-1 is a key component of efficient T-cell activation |
26283571 | These results suggest that CAT-1 is a novel CAM that directly regulates endothelial integrity and mediates the protective actions of L-Arg to endothelium via a NO-independent mechanism. |
25477137 | TRPV6 and PLC-delta1 are critical actor of Ca(2+) homeostasis in CF human bronchial epithelial cells. |
25372600 | focus on TRPV6 gene polymorphisms, the start of TRPV6 translation at a non-AUG codon and the functions of TRPV6 in intestinal Ca(2+) uptake, sperm maturation, and male fertility. |
25172921 | TRPV6 channel acquires its oncogenic potential in prostate cancer due to the remodeling mechanism via the Orai1-mediated calcium/Annexin I/S100A11 pathway. |
25164318 | High TRPV6 expression is aassociated with adenoma of parathyroid glands. |
24761864 | Decreased expression of TRPV6 is associated with non-small cell lung cancer. |
24592736 | these data showed that TRPV5/TRPV6 in human lymphocytes are functionally active, and their activity is associated with proliferative status of blood cells. |
More... |
MGPLQGDGGPALGGADVAPRLSPVRVWPRPQAPKEPALHPMGLSLPKEKGLILCLWSKFCRWFQRRESWA 1 - 70 QSRDEQNLLQQKRIWESPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLME 71 - 140 AAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFA 141 - 210 ACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQG 211 - 280 LTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYDLTEIDSSGDEQSLLELIITTKKREARQILDQ 281 - 350 TPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRPLKPRTNNRTSPRDNTLLQQKLLQEAYMTP 351 - 420 KDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLISASGE 421 - 490 VVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEEL 491 - 560 GHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERD 561 - 630 ELWRAQIVATTVMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDLNRQRIQRYAQAFHTRGSEDLD 631 - 700 KDSVEKLELGCPFSPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQI 701 - 765 //
PMID | Year | Title |
---|---|---|
26818094 | 2016 | TRPV6 plays a new role in predicting survival of patients with esophageal squamous cell carcinoma. |
26563429 | 2015 | Fluid shear triggers microvilli formation via mechanosensitive activation of TRPV6. |
26449889 | 2016 | Induced arginine transport via cationic amino acid transporter-1 is necessary for human T-cell proliferation. |
26283571 | 2015 | CAT-1 as a novel CAM stabilizes endothelial integrity and mediates the protective actions of L-Arg via a NO-independent mechanism. |
25559186 | 2015 | TRP channel-associated factors are a novel protein family that regulates TRPM8 trafficking and activity. |
25477137 | 2015 | The low PLC-?1 expression in cystic fibrosis bronchial epithelial cells induces upregulation of TRPV6 channel activity. |
25372600 | 2014 | The transient receptor potential cation channel subfamily V member 6 (TRPV6): genetics, biochemical properties, and functions of exceptional calcium channel proteins. |
25172921 | 2014 | TRPV6 calcium channel translocates to the plasma membrane via Orai1-mediated mechanism and controls cancer cell survival. |
25164318 | 2014 | First evidence of TRPV5 and TRPV6 channels in human parathyroid glands: possible involvement in neoplastic transformation. |
24761864 | 2014 | Expression and prognostic roles of TRPV5 and TRPV6 in non-small cell lung cancer after curative resection. |
More... |