Property Summary

Ligand Count 4
NCBI Gene PubMed Count 97
PubMed Score 247.09
PubTator Score 184.43

Knowledge Summary

Patent (25,242)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.700 1.8e-04
atypical teratoid / rhabdoid tumor -1.400 3.8e-06
cutaneous lupus erythematosus -1.500 1.2e-03
glioblastoma -1.500 4.3e-05
intraductal papillary-mucinous adenoma (... -1.400 3.5e-03
intraductal papillary-mucinous neoplasm ... -1.500 2.1e-02
medulloblastoma, large-cell -1.600 4.1e-05
ovarian cancer -1.200 2.6e-05
psoriasis -1.300 7.7e-04

Gene RIF (81)

AA Sequence

MGPLQGDGGPALGGADVAPRLSPVRVWPRPQAPKEPALHPMGLSLPKEKGLILCLWSKFCRWFQRRESWA      1 - 70
QSRDEQNLLQQKRIWESPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLME     71 - 140
AAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFA    141 - 210
ACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQG    211 - 280
LTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYDLTEIDSSGDEQSLLELIITTKKREARQILDQ    281 - 350
TPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRPLKPRTNNRTSPRDNTLLQQKLLQEAYMTP    351 - 420
KDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLISASGE    421 - 490
VVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEEL    491 - 560
GHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERD    561 - 630
ELWRAQIVATTVMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDLNRQRIQRYAQAFHTRGSEDLD    631 - 700
KDSVEKLELGCPFSPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQI         701 - 765
//

Text Mined References (99)

PMID Year Title