Property Summary

NCBI Gene PubMed Count 94
Grant Count 57
R01 Count 39
Funding $6,340,579.72
PubMed Score 230.18
PubTator Score 184.43

Knowledge Summary

Patent (25,242)

Expression

Synonym

Accession Q9H1D0 A4D2I8 Q8TDL3 Q8WXR8 Q96LC5 Q9H1D1 Q9H296 TrpV6
Symbols CAT1
CATL
ZFAB
ECAC2
ABP/ZF
LP6728
HSA277909

Gene

PANTHER Protein Class (2)

Gene RIF (78)

PMID Text
26818094 TRPV6 is down-regulated in esophageal squamous cell carcinoma and plays a role in predicting survival of male and female patients.
26563429 TRPV6 calcium ion channel plays a critical role in flow-induced Ca(2+) influx and microvilli formation.
26449889 our results demonstrate that hCAT-1 is a key component of efficient T-cell activation
26283571 These results suggest that CAT-1 is a novel CAM that directly regulates endothelial integrity and mediates the protective actions of L-Arg to endothelium via a NO-independent mechanism.
25477137 TRPV6 and PLC-delta1 are critical actor of Ca(2+) homeostasis in CF human bronchial epithelial cells.
25372600 focus on TRPV6 gene polymorphisms, the start of TRPV6 translation at a non-AUG codon and the functions of TRPV6 in intestinal Ca(2+) uptake, sperm maturation, and male fertility.
25172921 TRPV6 channel acquires its oncogenic potential in prostate cancer due to the remodeling mechanism via the Orai1-mediated calcium/Annexin I/S100A11 pathway.
25164318 High TRPV6 expression is aassociated with adenoma of parathyroid glands.
24761864 Decreased expression of TRPV6 is associated with non-small cell lung cancer.
24592736 these data showed that TRPV5/TRPV6 in human lymphocytes are functionally active, and their activity is associated with proliferative status of blood cells.
More...

AA Sequence

MGPLQGDGGPALGGADVAPRLSPVRVWPRPQAPKEPALHPMGLSLPKEKGLILCLWSKFCRWFQRRESWA      1 - 70
QSRDEQNLLQQKRIWESPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLME     71 - 140
AAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFA    141 - 210
ACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQG    211 - 280
LTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYDLTEIDSSGDEQSLLELIITTKKREARQILDQ    281 - 350
TPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRPLKPRTNNRTSPRDNTLLQQKLLQEAYMTP    351 - 420
KDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLISASGE    421 - 490
VVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEEL    491 - 560
GHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERD    561 - 630
ELWRAQIVATTVMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDLNRQRIQRYAQAFHTRGSEDLD    631 - 700
KDSVEKLELGCPFSPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQI         701 - 765
//

Text Mined References (96)

PMID Year Title
26818094 2016 TRPV6 plays a new role in predicting survival of patients with esophageal squamous cell carcinoma.
26563429 2015 Fluid shear triggers microvilli formation via mechanosensitive activation of TRPV6.
26449889 2016 Induced arginine transport via cationic amino acid transporter-1 is necessary for human T-cell proliferation.
26283571 2015 CAT-1 as a novel CAM stabilizes endothelial integrity and mediates the protective actions of L-Arg via a NO-independent mechanism.
25559186 2015 TRP channel-associated factors are a novel protein family that regulates TRPM8 trafficking and activity.
25477137 2015 The low PLC-?1 expression in cystic fibrosis bronchial epithelial cells induces upregulation of TRPV6 channel activity.
25372600 2014 The transient receptor potential cation channel subfamily V member 6 (TRPV6): genetics, biochemical properties, and functions of exceptional calcium channel proteins.
25172921 2014 TRPV6 calcium channel translocates to the plasma membrane via Orai1-mediated mechanism and controls cancer cell survival.
25164318 2014 First evidence of TRPV5 and TRPV6 channels in human parathyroid glands: possible involvement in neoplastic transformation.
24761864 2014 Expression and prognostic roles of TRPV5 and TRPV6 in non-small cell lung cancer after curative resection.
More...