Property Summary

NCBI Gene PubMed Count 24
PubMed Score 43.33
PubTator Score 29.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 3.2e-05
atypical teratoid / rhabdoid tumor 1.500 2.1e-05
ependymoma 1.100 3.4e-02
glioblastoma 1.800 1.2e-03
lung carcinoma -1.900 1.2e-30
osteosarcoma 1.654 1.1e-05
pediatric high grade glioma 1.600 6.2e-05
tuberculosis 1.100 9.5e-06

 GO Function (1)

Gene RIF (14)

AA Sequence

MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGVLKNVLAASAG      1 - 70
GMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVLIRFFGTKWMMF     71 - 140
LAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMGNYITRMAQKYHEYSHYKEQDGQGMKQRPPR    141 - 210
GSHAPYLLVFQAIFYSFFHLSFACAQLPMIYFLNHYLYDLNHTLYNVQSCGTNSHGILSGFNKTVLRTLP    211 - 280
RSGNLIVVESVLMAVAFLAMLLVLGLCGAAYRPTEEIDLRSVGWGNIFQLPFKHVRDYRLRHLVPFFIYS    281 - 350
GFEVLFACTGIALGYGVCSVGLERLAYLLVAYSLGASAASLLGLLGLWLPRPVPLVAGAGVHLLLTFILF    351 - 420
FWAPVPRVLQHSWILYVAAALWGVGSALNKTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSS    421 - 490
LHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDESDAEGEHGDGA    491 - 560
EEEAPPAGPRPGPEPAGLGRRPCPYEQAQGGDGPEEQ                                     561 - 597
//

Text Mined References (29)

PMID Year Title