Property Summary

NCBI Gene PubMed Count 24
Grant Count 44
R01 Count 25
Funding $4,164,292.85
PubMed Score 40.72
PubTator Score 29.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma 1.500 0.000
osteosarcoma 1.654 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.800 0.001
tuberculosis 1.100 0.000
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.200 0.000
lung carcinoma -1.900 0.000

 GO Function (1)

Gene RIF (14)

PMID Text
26466955 Endosomal localization of endogenous TLR3 was decreased by silencing of LRRC59, suggesting that LRRC59 promotes UNC93B1-mediated translocation of NA-sensing TLRs from the ER upon infection.
25187660 the UNC93B1 tyrosine-based motif regulates trafficking and TLR responses via separate mechanisms.
23166319 TLR3 is the important regulator of UNC93B1 that in turn governs the responsiveness of all TLR3 as the important regulator of UNC93B1 that in turn governs the responsiveness of all NAS Toll-like receptors
23002119 IgM(+)IgD(+)CD27(+) but not switched B cells were strongly reduced in MYD88-, IRAK-4-, and TIRAP-deficient patients, but not UNC-93B-deficient patients.
22611194 UNC93B1 expression is required for TLR3 cleavage and signaling.
22164301 UNC93B1 physically associates with human TLR8 and regulates TLR8-mediated signaling
21173679 To date only 2 children with UNC-93B deficiencies have been identified after isolated HSV-1 encephalitis.
19120481 Individuals with congenital mutations develop severe HSV-1 encephalitis
19120473 regulates ligand-induced trafficking of TLR7 and TLR9 from the ER to endolysosomes, potential therapeutic target for controlling dysregulated TLR7/9 responses in autoimmune diseases
19006693 IRAK-4-, MyD88-, and UNC-93B-deficient patients did not display autoreactive antibodies in their serum or develop autoimmune diseases, suggesting that IRAK-4, MyD88, and UNC-93B pathway blockade may thwart autoimmunity in humans.
More...

AA Sequence

MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGVLKNVLAASAG      1 - 70
GMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVLIRFFGTKWMMF     71 - 140
LAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMGNYITRMAQKYHEYSHYKEQDGQGMKQRPPR    141 - 210
GSHAPYLLVFQAIFYSFFHLSFACAQLPMIYFLNHYLYDLNHTLYNVQSCGTNSHGILSGFNKTVLRTLP    211 - 280
RSGNLIVVESVLMAVAFLAMLLVLGLCGAAYRPTEEIDLRSVGWGNIFQLPFKHVRDYRLRHLVPFFIYS    281 - 350
GFEVLFACTGIALGYGVCSVGLERLAYLLVAYSLGASAASLLGLLGLWLPRPVPLVAGAGVHLLLTFILF    351 - 420
FWAPVPRVLQHSWILYVAAALWGVGSALNKTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSS    421 - 490
LHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDESDAEGEHGDGA    491 - 560
EEEAPPAGPRPGPEPAGLGRRPCPYEQAQGGDGPEEQ                                     561 - 597
//

Text Mined References (29)

PMID Year Title
26466955 2015 LRRC59 Regulates Trafficking of Nucleic Acid-Sensing TLRs from the Endoplasmic Reticulum via Association with UNC93B1.
25187660 2014 Cutting edge: the UNC93B1 tyrosine-based motif regulates trafficking and TLR responses via separate mechanisms.
24439965 2014 Trafficking of endosomal Toll-like receptors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166319 2013 The role of UNC93B1 protein in surface localization of TLR3 receptor and in cell priming to nucleic acid agonists.
23002119 2012 IgM+IgD+CD27+ B cells are markedly reduced in IRAK-4-, MyD88-, and TIRAP- but not UNC-93B-deficient patients.
22611194 2012 Cleavage of Toll-like receptor 3 by cathepsins B and H is essential for signaling.
22164301 2011 UNC93B1 physically associates with human TLR8 and regulates TLR8-mediated signaling.
21642595 2011 BAD-LAMP is a novel biomarker of nonactivated human plasmacytoid dendritic cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...