Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.15
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -1.700 4.0e-02
adrenocortical adenoma -1.156 1.8e-02
Atopic dermatitis -1.400 3.3e-03
atypical teratoid / rhabdoid tumor -2.100 3.4e-04
Breast cancer -2.400 3.5e-02
breast carcinoma -1.300 7.8e-19
cystic fibrosis 1.757 2.2e-06
Duchenne muscular dystrophy 1.333 8.4e-08
ependymoma -1.400 7.3e-03
gastric carcinoma 1.100 3.4e-02
intraductal papillary-mucinous adenoma (... -1.600 5.3e-05
intraductal papillary-mucinous carcinoma... -1.700 5.4e-05
intraductal papillary-mucinous neoplasm ... -1.400 2.2e-03
invasive ductal carcinoma -1.600 1.1e-02
lung cancer -1.800 2.4e-04
malignant mesothelioma -4.600 2.3e-08
medulloblastoma, large-cell 1.900 2.0e-02
osteosarcoma 1.870 8.2e-03
ovarian cancer -1.100 2.3e-07
pancreatic cancer 1.200 3.4e-03
pituitary cancer -1.500 1.4e-05
primary pancreatic ductal adenocarcinoma 2.169 6.4e-04
ulcerative colitis 1.900 5.9e-04

Protein-protein Interaction (4)

Gene RIF (7)

AA Sequence

MALLRKINQVLLFLLIVTLCVILYKKVHKGTVPKNDADDESETPEELEEEIPVVICAAAGRMGATMAAIN      1 - 70
SIYSNTDANILFYVVGLRNTLTRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRF     71 - 140
YLPLLIHQHEKVIYLDDDVIVQGDIQELYDTTLALGHAAAFSDDCDLPSAQDINRLVGLQNTYMGYLDYR    141 - 210
KKAIKDLGISPSTCSFNPGVIVANMTEWKHQRITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGK    211 - 280
YSTINPLWHIRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDPAGIFKLNHHS     281 - 349
//

Text Mined References (10)

PMID Year Title