Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.15
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Biliary Cirrhosis, Secondary 5
Disease Target Count P-value
breast carcinoma 1614 7.79358468188945E-19
malignant mesothelioma 3163 2.2912986941033E-8
ovarian cancer 8492 2.87424318043022E-8
Duchenne muscular dystrophy 602 8.38157862447844E-8
pituitary cancer 1972 4.70165110110354E-5
cystic fibrosis 1670 7.33670806399597E-5
lung cancer 4473 2.41445327686962E-4
atypical teratoid / rhabdoid tumor 4369 3.40451341516128E-4
ulcerative colitis 2087 5.87018310567857E-4
primary pancreatic ductal adenocarcinoma 1271 6.40156408729275E-4
pancreatic cancer 2300 0.00132211933794735
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00306727307275946
Atopic dermatitis 944 0.00331066526628884
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0035269315682887
ependymoma 2514 0.00726060376937817
osteosarcoma 7933 0.00816731328318901
invasive ductal carcinoma 2950 0.0107882910893577
gastric carcinoma 832 0.0144886967181049
adrenocortical adenoma 134 0.0178923753642162
medulloblastoma, large-cell 6234 0.0203564824408142
Breast cancer 3099 0.0354101371960353
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0385689906484513
acute myeloid leukemia 785 0.0397897422601414
Disease Target Count Z-score Confidence
Corneal disease 32 0.0 2.0
Liver Cirrhosis 101 0.0 2.0
Disease Target Count Z-score Confidence
Fatty liver disease 86 3.094 1.5

Expression

Synonym

Accession Q9H1C3 Q96KA2
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (7)

PMID Text
25952508 role in nonalcoholic fatty liver disease pathogenesis possibly by negatively regulating MTP expression
24173238 Based on these results, we propose that GLT8D2 is a glycosyltransferase of apoB100 that regulates apoB100 levels in hepatocytes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
8218172 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2649653 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2341393 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2283726 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase

AA Sequence

MALLRKINQVLLFLLIVTLCVILYKKVHKGTVPKNDADDESETPEELEEEIPVVICAAAGRMGATMAAIN      1 - 70
SIYSNTDANILFYVVGLRNTLTRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRF     71 - 140
YLPLLIHQHEKVIYLDDDVIVQGDIQELYDTTLALGHAAAFSDDCDLPSAQDINRLVGLQNTYMGYLDYR    141 - 210
KKAIKDLGISPSTCSFNPGVIVANMTEWKHQRITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGK    211 - 280
YSTINPLWHIRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDPAGIFKLNHHS     281 - 349
//

Text Mined References (10)

PMID Year Title
25952508 2015 Mechanism of the effect of glycosyltransferase GLT8D2 on fatty liver.
24173238 2013 Glycosyltransferase GLT8D2 positively regulates ApoB100 protein expression in hepatocytes.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22841784 2012 Genome-wide association study identifies variants associated with progression of liver fibrosis from HCV infection.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.