Property Summary

Ligand Count 11
NCBI Gene PubMed Count 19
PubMed Score 32.17
PubTator Score 22.67

Knowledge Summary

Patent (3,365)

Expression

 CSPA Cell Line (3)

Gene RIF (11)

AA Sequence

MLANSSSTNSSVLPCPDYRPTHRLHLVVYSLVLAAGLPLNALALWVFLRALRVHSVVSVYMCNLAASDLL      1 - 70
FTLSLPVRLSYYALHHWPFPDLLCQTTGAIFQMNMYGSCIFLMLINVDRYAAIVHPLRLRHLRRPRVARL     71 - 140
LCLGVWALILVFAVPAARVHRPSRCRYRDLEVRLCFESFSDELWKGRLLPLVLLAEALGFLLPLAAVVYS    141 - 210
SGRVFWTLARPDATQSQRRRKTVRLLLANLVIFLLCFVPYNSTLAVYGLLRSKLVAASVPARDRVRGVLM    211 - 280
VMVLLAGANCVLDPLVYYFSAEGFRNTLRGLGTPHRARTSATNGTRAALAQSERSAVTTDATRPDAASQG    281 - 350
LLRPSDSHSLSSFTQCPQDSAL                                                    351 - 372
//

Text Mined References (19)

PMID Year Title