Property Summary

NCBI Gene PubMed Count 19
Grant Count 10
R01 Count 10
Funding $581,882.38
PubMed Score 28.63
PubTator Score 22.67

Knowledge Summary

Patent (3,365)

Expression

Gene RIF (11)

PMID Text
25849892 These results suggest that the diverse roles of LPA4, LPA5 and LPA6 are involved in the activation of tumor progression in pancreatic cancer cells.
25294670 Down-regulation of LPA receptor 5 contributes to aberrant LPA signalling in EBV-associated nasopharyngeal carcinoma.
24676544 MMP-2 and MMP-9 were found in HT1080L5 cells, in comparison with control cells. These results suggest that LPA signaling via LPA5 negatively regulates the cell motile and invasive activities of human sarcoma cells.
24632199 These results suggest that LPA5 may act as a negative regulator of cellular responses in mouse fibroblast 3T3 cells, similar to the case for LPA1.
21832242 It was shown that lysophosphatidic acid 5 receptor transactivated the epidermal growth factor receptor and that inhibition of epidermal growth factor receptor blocked lysophosphatidic acid 5 receptor-dependent activation of NHE3.
21464938 LPA5 is a bona fide LPA receptor on human mast cells responsible for the majority of LPA induced MIP-1beta release.
20069565 LPA4 and LPA5 receptors induce osteoblastic differentiation of human mesenchymal stem cells
19860625 Data show that CLL cells express LPA receptors LPA(1-5) and VEGF receptors, and the plasma levels of VEGF are elevated in CLL patients.
19366702 Four residues involved in ligand recognition in LPA(5) were identified as follows: R2.60N mutant abolished receptor activation, whereas H4.64E, R6.62A, and R7.32A greatly reduced receptor activation.
18499677 FPP and NAG play a role in the sensory nervous system through activation of GPR92
More...

AA Sequence

MLANSSSTNSSVLPCPDYRPTHRLHLVVYSLVLAAGLPLNALALWVFLRALRVHSVVSVYMCNLAASDLL      1 - 70
FTLSLPVRLSYYALHHWPFPDLLCQTTGAIFQMNMYGSCIFLMLINVDRYAAIVHPLRLRHLRRPRVARL     71 - 140
LCLGVWALILVFAVPAARVHRPSRCRYRDLEVRLCFESFSDELWKGRLLPLVLLAEALGFLLPLAAVVYS    141 - 210
SGRVFWTLARPDATQSQRRRKTVRLLLANLVIFLLCFVPYNSTLAVYGLLRSKLVAASVPARDRVRGVLM    211 - 280
VMVLLAGANCVLDPLVYYFSAEGFRNTLRGLGTPHRARTSATNGTRAALAQSERSAVTTDATRPDAASQG    281 - 350
LLRPSDSHSLSSFTQCPQDSAL                                                    351 - 372
//

Text Mined References (19)

PMID Year Title
25849892 2015 Diverse effects of LPA4, LPA5 and LPA6 on the activation of tumor progression in pancreatic cancer cells.
25294670 2015 Down-regulation of LPA receptor 5 contributes to aberrant LPA signalling in EBV-associated nasopharyngeal carcinoma.
24676544 2014 Lysophosphatidic acid receptor-5 negatively regulates cell motile and invasive activities of human sarcoma cell lines.
24632199 2014 Lysophosphatidic acid receptor-5 negatively regulates cellular responses in mouse fibroblast 3T3 cells.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
21832242 2011 Lysophosphatidic acid 5 receptor induces activation of Na(+)/H(+) exchanger 3 via apical epidermal growth factor receptor in intestinal epithelial cells.
21464938 2011 LPA5 is abundantly expressed by human mast cells and important for lysophosphatidic acid induced MIP-1? release.
20069565 2010 LPA induces osteoblast differentiation through interplay of two receptors: LPA1 and LPA4.
19860625 2009 Lysophosphatidic acid receptor expression in chronic lymphocytic leukemia leads to cell survival mediated though vascular endothelial growth factor expression.
19366702 2009 Unique ligand selectivity of the GPR92/LPA5 lysophosphatidate receptor indicates role in human platelet activation.
More...