Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.27
PubTator Score 5.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Dermatitis 157 0.0 1.0
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 30 3.373 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.322 5.0e-05
fascioscapulohumeral muscular dystrophy 1.073 2.8e-05
juvenile dermatomyositis 1.411 4.6e-13

Gene RIF (1)

AA Sequence

MSAAQVSSSRRQSCYLCDLPRMPWAMIWDFSEPVCRGCVNYEGADRIEFVIETARQLKRAHGCFQDGRSP      1 - 70
GPPPPVGVKTVALSAKEAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQLNHVDGSSKPAVL     71 - 140
AAPSGLERYGLSAAAAAAAAAAAAVEQRSRFEYPPPPVSLGSSSHTARLPNGLGGPNGFPKPTPEEGPPE    141 - 210
LNRQSPNSSSAAASVASRRGTHGGLVTGLPNPGGGGGPQLTVPPNLLPQTLLNGPASAAVLPPPPPHALG    211 - 280
SRGPPTPAPPGAPGGPACLGGTPGVSATSSSASSSTSSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRN    281 - 350
AEALAELSESLRNRAEEWASKPKMVRDTLLTLAGCTPYEVRFKKDHSLLGRVFAFDAVSKPGMDYELKLF    351 - 420
IEYPTGSGNVYSSASGVAKQMYQDCMKDFGRGLSSGFKYLEYEKKHGSGDWRLLGDLLPEAVRFFKEGVP    421 - 490
GADMLPQPYLDASCPMLPTALVSLSRAPSAPPGTGALPPAAPSGRGAAASLRKRKASPEPPDSAEGALKL    491 - 560
GEEQQRQQWMANQSEALKLTMSAGGFAAPGHAAGGPPPPPPPLGPHSNRTTPPESAPQNGPSPMAALMSV    561 - 630
ADTLGTAHSPKDGSSVHSTTASARRNSSSPVSPASVPGQRRLASRNGDLNLQVAPPPPSAHPGMDQVHPQ    631 - 700
NIPDSPMANSGPLCCTICHERLEDTHFVQCPSVPSHKFCFPCSRESIKAQGATGEVYCPSGEKCPLVGSN    701 - 770
VPWAFMQGEIATILAGDVKVKKERDP                                                771 - 796
//

Text Mined References (27)

PMID Year Title