Property Summary

NCBI Gene PubMed Count 26
PubMed Score 412.34
PubTator Score 51.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Pseudoxanthoma elasticum 18 0.0 0.0
Disease Target Count
Spondylo-ocular syndrome 1
Disease Target Count P-value
osteosarcoma 7950 5.8e-09
psoriasis 6694 6.0e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Spondyloocular Syndrome 1

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.834 5.8e-09
psoriasis -3.000 6.0e-06

Gene RIF (20)

AA Sequence

MVASARVQKLVRRYKLAIATALAILLLQGLVVWSFSGLEEDEAGEKGRQRKPRPLDPGEGSKDTDSSAGR      1 - 70
RGSTGRRHGRWRGRAESPGVPVAKVVRAVTSRQRASRRVPPAPPPEAPGRQNLSGAAAGEALVGAAGFPP     71 - 140
HGDTGSVEGAPQPTDNGFTPKCEIVGKDALSALARASTKQCQQEIANVVCLHQAGSLMPKAVPRHCQLTG    141 - 210
KMSPGIQWDESQAQQPMDGPPVRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSDYLHREVVEL    211 - 280
AQGYDNVRVTPWRMVTIWGGASLLRMYLRSMRDLLEVPGWAWDFFINLSATDYPTRTNEELVAFLSKNRD    281 - 350
KNFLKSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGSDWFVLTRSFVEYVVYTDDPLV    351 - 420
AQLRQFYTYTLLPAESFFHTVLENSLACETLVDNNLRVTNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDF    421 - 490
LRLQQVSRPTFFARKFESTVNQEVLEILDFHLYGSYPPGTPALKAYWENTYDAADGPSGLSDVMLTAYTA    491 - 560
FARLSLHHAATAAPPMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMWLMPQGS    561 - 630
LKLLGRSDQASRLQSLEVGTDWDPKERLFRNFGGLLGPLDEPVAVQRWARGPNLTATVVWIDPTYVVATS    631 - 700
YDITVDTETEVTQYKPPLSRPLRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPH    701 - 770
NEYMEQSFQGLSSILNLPQPELAEEAAQRHTQLTGPALEAWTDRELSSFWSVAGLCAIGPSPCPSLEPCR    771 - 840
LTSWSSLSPDPKSELGPVKADGRLR                                                 841 - 865
//

Text Mined References (27)

PMID Year Title