Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.17
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI      1 - 70
IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP                              71 - 115
//

Text Mined References (9)

PMID Year Title