Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.17
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H1A7 A6NKA1 RNA polymerase II subunit B11-b2
Symbols POLR2J2
RPB11b1
RPB11b2

Gene

 GO Component (1)

AA Sequence

MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI      1 - 70
IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP                              71 - 115
//

Text Mined References (9)

PMID Year Title
16913423 Human PMS2 gene family: origin, molecular evolution, and biological implications.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15987790 2005 Distinct regions of RPB11 are required for heterodimerization with RPB3 in human and yeast RNA polymerase II.
15586814 [New genes on human chromosome 7: bioinformatic analysis of a gene cluster from the POLR2J family].
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036295 2002 The thymocyte-specific MAR binding protein, SATB1, interacts in vitro with a novel variant of DNA-directed RNA polymerase II, subunit 11.
11747469 2001 A human RNA polymerase II subunit is encoded by a recently generated multigene family.
9847074 1998 Toward a complete human genome sequence.