Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.54
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H195 Q6W762 Q7LDU5 Q9GZZ2 Q9UN95 MUC-3B
Symbols MUC3
MUC3A

Gene

Gene RIF (2)

PMID Text
18163520 up-regulated MUC expression by synovial tissue cells and suggest a novel role of MUC3 and MUC5AC in the pathogenesis of arthritis
12958310 has highly conserved amino and carboxyl termini, suggesting a recent duplication of the entire ancestral gene

AA Sequence

MQLLGLLSILWMLKSSPGATGTLSTATSTSHVTFPRAEATRTALSNSPHSRYLAEWPQGVPQLASPAPGH      1 - 70
RENAPMTLTTSPHDTLISETLLSSLVSSNTSTTPTSKFAFKVETTPPTVLVYSATTECVYPTSFIITISH     71 - 140
STSICVTTTQVTFTSSYTPTPVTQKPVTTVTRTYPMTTTEKGTSAMISSPSTTTARETPIVTVTPSSSVS    141 - 210
ATDTTFHTTISSTTRTTERTPLPTGSIHTTMSPTPVFTTLKTAVTSTSPITSTITSTNTVTSMTTTTSRP    211 - 280
TATNTLSSLTSSILSSTPAPNTEVITSHTTTTTPPSTLVTTLPTAIARSTPTSETTPSFMSSIITTETTS    281 - 350
HSTPSFSSSTIHSTVSSSTTAITSPFTTAETGVTSTPSSPSSLSTDIPTTSLRTLTPLSLSTSTSLTTTT    351 - 420
DLPSIPTDISSLPTPIHIISSSPSIQSTETSSLVGTTSPTMSTVRATLRSTENTPISSFSTSIVVTPETP    421 - 490
TTQAPPVLMSATGTQTSPVPTTVTFGSMDSSTSTLHTLTPSTALSKIMSTSQFPIPSTHSSTLQTTPSIP    491 - 560
SLQTSLTSTSEFTTESFTRGSTSTNAILTSFSTIIWSSTPTIIMSSSPSSASITPVFATTIHSVPSSPYI    561 - 630
FSTENVGSASITAFPSLSSSSTTSTSPTSSSLTTALTEITPFSYISLPSTTPCPGTITITIVPASPTDPC    631 - 700
VEMDPSTEATSPPTTPLTVFPFTTEMVTCPSSISMQTTLATHMDTSSMTPESESSIIPNASSSTGTGTVP    701 - 770
TNTVFTSTRLPTSETWLSNNSVIPTPLPGVSTIPLTMKPSSSLPTILRTSSKSTHPSPPTARTSQTSVAT    771 - 840
TQTPTTLTTCRTTPITSWMTTQSTLTTTAGTCDNGGTWEQGQCACLPGFSGDRCQLQTRCQNGGQWDGLK    841 - 910
CQCPSTFYGSSCEFAVEQVDLDVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFADMQG    911 - 980
FTFKGVEILSLRNGSIVVDYLVLLEMPFSPQLESEYEQVKTTLKEGLQNASQDANSCQDSQALCFKPDSI    981 - 1050
KVNNNSKTELTPEAICRRAAPTGYEEFYFPLVEATRLRCVTKCTSGLDNAIDCHQGQCVLETSGPACRCY   1051 - 1120
STDTHWFSGPRCEVTVHWRALVGGLTAGAALLVLLLLALGVRAVRSEWWGRQRRGRSWDQDRKWFETWDE   1121 - 1190
EVVGTFSNWGFEDDGTDKDTNFHVALENVDTTMKVHIKRPEMTSSSV                          1191 - 1237
//

Text Mined References (9)

PMID Year Title
18163520 2008 Expression of mucin 3 and mucin 5AC in arthritic synovial tissue.
12958310 2003 Initiation of transcription of the MUC3A human intestinal mucin from a TATA-less promoter and comparison with the MUC3B amino terminus.
12853948 2003 The DNA sequence of human chromosome 7.
11289722 2001 Associations of distinct variants of the intestinal mucin gene MUC3A with ulcerative colitis and Crohn's disease.
10973822 2000 Multiple transcripts of MUC3: evidence for two genes, MUC3A and MUC3B.
10512748 1999 Genomic organization and structure of the 3' region of human MUC3: alternative splicing predicts membrane-bound and soluble forms of the mucin.
10405327 1999 The MUC3 gene encodes a transmembrane mucin and is alternatively spliced.
9334251 1997 MUC3 human intestinal mucin. Analysis of gene structure, the carboxyl terminus, and a novel upstream repetitive region.
2393399 1990 Molecular cloning of cDNAs derived from a novel human intestinal mucin gene.