Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.36
PubTator Score 8.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 3 medulloblastoma 2254 1.3126435107092E-6
medulloblastoma, large-cell 6234 3.16991225215435E-5
nasopharyngeal carcinoma 1056 3.69478975814566E-5
osteosarcoma 7933 2.24349488146601E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.75384973542313E-4
primary pancreatic ductal adenocarcinoma 1271 0.00445984184464802
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00473423111617017
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00586899386701557
pancreatic cancer 2300 0.0108347299521139
spina bifida 1064 0.0480292887272985

Expression

Synonym

Accession Q9H190 O95892 Q5W0X1 Q9BZ42 Q9H567 Q9NRY8
Symbols ST-2
SITAC
SITAC18

Gene

  Ortholog (9)

Gene RIF (2)

PMID Text
22721673 HIV-1 Nef inhibits the expression of syndecan binding protein (syntenin) in human podocyte
22623796 These results identified syntenin-2 as the first PDZ domain protein controlled by HPV8 and HPV16 at the mRNA level.

AA Sequence

MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQI      1 - 70
PEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTP     71 - 140
ASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKG    141 - 210
KIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVL    211 - 280
LHHTMDHSIPDA                                                              281 - 292
//

Text Mined References (23)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22623796 2012 Human papillomavirus type 8 E6 oncoprotein inhibits transcription of the PDZ protein syntenin-2.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16884951 2006 The prevalence and significance of PDZ domain-phosphoinositide interactions.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...