Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.36
PubTator Score 8.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
22721673 HIV-1 Nef inhibits the expression of syndecan binding protein (syntenin) in human podocyte
22623796 These results identified syntenin-2 as the first PDZ domain protein controlled by HPV8 and HPV16 at the mRNA level.

AA Sequence

MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQI      1 - 70
PEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTP     71 - 140
ASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKG    141 - 210
KIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVL    211 - 280
LHHTMDHSIPDA                                                              281 - 292
//

Text Mined References (23)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22623796 2012 Human papillomavirus type 8 E6 oncoprotein inhibits transcription of the PDZ protein syntenin-2.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16884951 2006 The prevalence and significance of PDZ domain-phosphoinositide interactions.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...