Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.25
PubTator Score 8.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQI      1 - 70
PEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTP     71 - 140
ASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKG    141 - 210
KIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVL    211 - 280
LHHTMDHSIPDA                                                              281 - 292
//

Text Mined References (25)

PMID Year Title