Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1062.27
PubTator Score 54.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.400 4.2e-05
subependymal giant cell astrocytoma 2.350 1.3e-03

 GWAS Trait (1)

Protein-protein Interaction (12)

Gene RIF (20)

AA Sequence

MAPQSLPSSRMAPLGMLLGLLMAACFTFCLSHQNLKEFALTNPEKSSTKETERKETKAEEELDAEVLEVF      1 - 70
HPTHEWQALQPGQAVPAGSHVRLNLQTGEREAKLQYEDKFRNNLKGKRLDINTNTYTSQDLKSALAKFKE     71 - 140
GAEMESSKEDKARQAEVKRLFRPIEELKKDFDELNVVIETDMQIMVRLINKFNSSSSSLEEKIAALFDLE    141 - 210
YYVHQMDNAQDLLSFGGLQVVINGLNSTEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATE    211 - 280
QPLTAKKKVLFALCSLLRHFPYAQRQFLKLGGLQVLRTLVQEKGTEVLAVRVVTLLYDLVTEKMFAEEEA    281 - 350
ELTQEMSPEKLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCRDRYRQDPQLGR    351 - 420
TLASLQAEYQVLASLELQDGEDEGYFQELLGSVNSLLKELR                                 421 - 461
//

Text Mined References (33)

PMID Year Title