Property Summary

NCBI Gene PubMed Count 27
PubMed Score 101.10
PubTator Score 23.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Sitosterolemia 9 3.569 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.600 6.2e-06
Astrocytoma, Pilocytic -1.100 5.9e-07
atypical teratoid / rhabdoid tumor -1.100 1.6e-07
ependymoma -1.500 1.4e-19
glioblastoma -1.500 3.3e-12
medulloblastoma -1.200 7.4e-06
psoriasis 2.000 1.9e-05

Gene RIF (18)

AA Sequence

MAEKALEAVGCGLGPGAVAMAVTLEDGAEPPVLTTHLKKVENHITEAQRFSHLPKRSAVDIEFVELSYSV      1 - 70
REGPCWRKRGYKTLLKCLSGKFCRRELIGIMGPSGAGKSTFMNILAGYRESGMKGQILVNGRPRELRTFR     71 - 140
KMSCYIMQDDMLLPHLTVLEAMMVSANLKLSEKQEVKKELVTEILTALGLMSCSHTRTALLSGGQRKRLA    141 - 210
IALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKSLAQGGRTIICTIHQPSAKLFEMFDKLYILSQGQCI    211 - 280
FKGVVTNLIPYLKGLGLHCPTYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAP    281 - 350
CPPCPPEVDPIESHTFATSTLTQFCILFKRTFLSILRDTVLTHLRFMSHVVIGVLIGLLYLHIGDDASKV    351 - 420
FNNTGCLFFSMLFLMFAALMPTVLTFPLEMAVFMREHLNYWYSLKAYYLAKTMADVPFQVVCPVVYCSIV    421 - 490
YWMTGQPAETSRFLLFSALATATALVAQSLGLLIGAASNSLQVATFVGPVTAIPVLLFSGFFVSFKTIPT    491 - 560
YLQWSSYLSYVRYGFEGVILTIYGMERGDLTCLEERCPFREPQSILRALDVEDAKLYMDFLVLGIFFLAL    561 - 630
RLLAYLVLRYRVKSER                                                          631 - 646
//

Text Mined References (28)

PMID Year Title