Property Summary

NCBI Gene PubMed Count 28
PubMed Score 223.59
PubTator Score 56.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 3.100 1.1e-04
interstitial cystitis 2.000 3.2e-03
osteosarcoma -1.261 1.5e-04
periodontitis 1.500 7.1e-22
psoriasis 2.200 2.6e-68
tuberculosis 1.600 4.4e-06
ulcerative colitis 2.300 2.2e-07

 GWAS Trait (1)

Gene RIF (17)

AA Sequence

MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGG      1 - 70
TDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDV     71 - 140
NRDLYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNGPNSWISIANSEAIQIGH    141 - 210
GNIITRQTVSREDGSAGPRHLPSMAPGDSSTWGTLVDPWGPQDIHMEQSILRRVQLGHSNEMRLHGVPSE    211 - 280
GPAHIPPGSPPVSATAAGPEASFEARIPSPGTHPEGEAAQRIHMKSCFLEDATIGNSNKMSISPGVAGPG    281 - 350
GVAGSGEGEPGEDAGRRPADTQSRSHFPRDIGQPITPSHSKLTPKLETMTLGNRSHKAAEGSHYVDEASH    351 - 420
EGSWWGGGI                                                                 421 - 429
//

Text Mined References (28)

PMID Year Title