Property Summary

NCBI Gene PubMed Count 28
Grant Count 33
R01 Count 23
Funding $5,099,858.92
PubMed Score 196.85
PubTator Score 56.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 3.100 0.000
osteosarcoma -3.090 0.000
periodontitis 1.500 0.000
tuberculosis 1.600 0.000
interstitial cystitis 2.300 0.001
ulcerative colitis 2.300 0.000
psoriasis 2.200 0.000

Gene RIF (17)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of ZBP1 in human monocyte-derived dendritic cells
24080302 Our results show that HSV2 is detected by a plethora of PRRs including DAI protein which trigger cytokine secretion to protect the host.
23553627 DAI could function as a DNA sensor and a regulator in DNA-induced macrophage M2b polarization and lupus nephritis.
23283962 Collectively, these results demonstrate that DAI can suppress HSV-1 growth independent of DNA sensing through mechanisms involving suppression of viral genomes and regulation of ICP0.
22240322 The data of this study suggest that RNA-binding proteins can be used as a tool to identify the post-transcriptional regulation of gene expression in the establishment and function of neural circuits involved in addiction behaviors.
22114317 these data indicate that ZBP1 may function as an adapter to export the Ro/Y3 RNA complex from nuclei.
21471454 Solution structure of the Zbeta domain of human DNA-dependent activator of IFN-regulatory factors and its binding modes to B- and Z-DNAs.
21296080 hZbeta(DAI) binds to Z-DNA via an active-di B-Z transition mechanism.
20599623 These results suggest that activation of DAI might contribute to augment HIV-1 replication through DAI- NF-kappaB pathway.
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGG      1 - 70
TDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDV     71 - 140
NRDLYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNGPNSWISIANSEAIQIGH    141 - 210
GNIITRQTVSREDGSAGPRHLPSMAPGDSSTWGTLVDPWGPQDIHMEQSILRRVQLGHSNEMRLHGVPSE    211 - 280
GPAHIPPGSPPVSATAAGPEASFEARIPSPGTHPEGEAAQRIHMKSCFLEDATIGNSNKMSISPGVAGPG    281 - 350
GVAGSGEGEPGEDAGRRPADTQSRSHFPRDIGQPITPSHSKLTPKLETMTLGNRSHKAAEGSHYVDEASH    351 - 420
EGSWWGGGI                                                                 421 - 429
//

Text Mined References (28)

PMID Year Title
24080302 2014 Herpes simplex virus 2-induced activation in vaginal cells involves Toll-like receptors 2 and 9 and DNA sensors DAI and IFI16.
23553627 2013 DNA-dependent activator of interferon-regulatory factors (DAI) promotes lupus nephritis by activating the calcium pathway.
23283962 2013 DNA sensing-independent inhibition of herpes simplex virus 1 replication by DAI/ZBP1.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22240322 2012 Transgenic expression of ZBP1 in neurons suppresses cocaine-associated conditioning.
22114317 2012 The zipcode-binding protein ZBP1 influences the subcellular location of the Ro 60-kDa autoantigen and the noncoding Y3 RNA.
21471454 2011 Solution structure of the Zbeta domain of human DNA-dependent activator of IFN-regulatory factors and its binding modes to B- and Z-DNAs.
21296080 2011 The Z? domain of human DAI binds to Z-DNA via a novel B-Z transition pathway.
20599623 2010 DNA-dependent activator of IFN-regulatory factors enhances the transcription of HIV-1 through NF-?B.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...